Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_057509293.1 ABB28_RS14455 2-hydroxyacid dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_001431535.1:WP_057509293.1 Length = 334 Score = 101 bits (252), Expect = 2e-26 Identities = 83/265 (31%), Positives = 117/265 (44%), Gaps = 19/265 (7%) Query: 63 LKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELAEWVK 122 ++A+ GF+ D+A R G +A P E+ A+ +LI+ R+ V+ Sbjct: 73 VRAVLLRCAGFNNVDLAAAERLGFFVARVPAYSPEAVAEHTLALIMTLNRQTHRAFNRVR 132 Query: 123 AGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANPQAEEA 182 G++ L G + GKT GIVG G+IG A AR + M P + A Sbjct: 133 EGNFMLE---GLLGRTLHGKTAGIVGTGKIGLATAR---ILHGMGCTVLGHDPYPSPDFA 186 Query: 183 YGARRVELAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVDEKAL 242 V L +LLA +D V L PLT +T+HLI L MK A+L+N SRG VD A+ Sbjct: 187 GLGEFVSLQDLLARSDIVSLHCPLTIQTRHLINDDSLALMKPGAMLVNTSRGGLVDTDAV 246 Query: 243 IEALQNGTIHGAGLDVFETEP-----------LPSD--SPLLKLANVVALPHIGSATHET 289 I AL++ + +DV+E E + D L+ NV+ H G T E Sbjct: 247 IRALKSRQLGHLAIDVYEQESALFFQDRSGQIIDDDVFQRLMTFPNVLVTGHQGFFTTEA 306 Query: 290 RHAMARNAAENLVAALDGTLTSNIV 314 +A NL GT N V Sbjct: 307 LQEIAETTLGNLGHFAAGTECPNEV 331 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 334 Length adjustment: 28 Effective length of query: 293 Effective length of database: 306 Effective search space: 89658 Effective search space used: 89658 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory