Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate WP_083492062.1 ABB28_RS16290 ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >NCBI__GCF_001431535.1:WP_083492062.1 Length = 215 Score = 149 bits (376), Expect = 6e-41 Identities = 88/213 (41%), Positives = 125/213 (58%), Gaps = 6/213 (2%) Query: 17 EIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEGEDVTALDAEG 76 E+ L + + G ++G SG+GK+TLL L+ L+ PS G I + G + +LD E Sbjct: 7 EVHILDNISMTVHEGTSVAIVGASGSGKTTLLGLLAGLDLPSRGSITLAGSVLGSLDEEA 66 Query: 77 LRRFRQR-VGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELLARVGLSDHA 135 + R R VG +FQ F+LL + T A+NIA+PL LAG E ARV ++L VGLS A Sbjct: 67 RAQLRAREVGFVFQSFHLLPALTAAENIALPLELAG----REDPARVEQVLEAVGLSHRA 122 Query: 136 RKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASVLQLLAEINRELKLTI 195 R YP QLSGG++QRV +ARA RP IL DE T +LD T + LL +N + T+ Sbjct: 123 RHYPRQLSGGEQQRVALARAFVARPRILFADEPTGSLDQATGQHISDLLFALNADSATTL 182 Query: 196 VLITHEMDVIRRVCDQVAVMDGGAIVEQGDVAD 228 VL+TH++ + +R C + +D G + + AD Sbjct: 183 VLVTHDLRLAQR-CQFIHRIDNGRLQQVTHGAD 214 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 215 Length adjustment: 25 Effective length of query: 310 Effective length of database: 190 Effective search space: 58900 Effective search space used: 58900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory