Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate WP_057506765.1 ABB28_RS00615 N-formylglutamate deformylase
Query= reanno::Korea:Ga0059261_3962 (264 letters) >NCBI__GCF_001431535.1:WP_057506765.1 Length = 284 Score = 294 bits (753), Expect = 1e-84 Identities = 153/271 (56%), Positives = 184/271 (67%), Gaps = 12/271 (4%) Query: 2 IHVEQGSAPLIVSVPHAGTVIPADIQG-LVSPELARYDADLYVDHLYAFARGLDATIVRT 60 + V +G APL++S PH GT +P D+ G VSP LAR DAD +V LYAFARGL AT VR+ Sbjct: 8 LEVHEGDAPLLISFPHTGTALPDDLAGRFVSPWLARRDADWWVHELYAFARGLGATTVRS 67 Query: 61 TVSRTVIDVNRDPSGQTLYPGQFTTGLCPIQTFDGTPLYEPGALPDAHEIERRRAEWFDP 120 ++SR+VID+NRDPSG +LYPGQ TTGLCP+ TFD PLY+P PD EI RRR +F P Sbjct: 68 SISRSVIDLNRDPSGVSLYPGQNTTGLCPLTTFDNQPLYKPAQEPDEAEILRRREAYFAP 127 Query: 121 YHTALAIQIERLRAIHPAIVVYDAHSIRSVVPKLFDGELPNFNIGT-----NDGTSCAPA 175 YH ALA QI RLRA H +VVYDAHSIRS +P LFDGELP FN+GT TSC A Sbjct: 128 YHAALASQIARLRARHGTVVVYDAHSIRSRIPHLFDGELPQFNLGTAGPTGEVDTSCDNA 187 Query: 176 LTQAVEAICDASPYSRVTNGRFKGGWITRHYARPAGGVHSIQMELAMRTYLVETPAH--- 232 L+ VE +C S V NGRFKGGWITRHY+ GGVHS+QMELA R Y+ E A Sbjct: 188 LSDVVENLCRLSGLPHVRNGRFKGGWITRHYSDIPGGVHSLQMELACRGYMAEPAAEALD 247 Query: 233 ---WPPPWHEETAQACQSVLRPILSAAIDFA 260 WP P ++ A + L +L+A ++FA Sbjct: 248 AHSWPTPLDDDHATPLRHTLAQVLTACLEFA 278 Lambda K H 0.321 0.136 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 284 Length adjustment: 25 Effective length of query: 239 Effective length of database: 259 Effective search space: 61901 Effective search space used: 61901 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_057506765.1 ABB28_RS00615 (N-formylglutamate deformylase)
to HMM TIGR02017 (hutG: N-formylglutamate deformylase (EC 3.5.1.68))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02017.hmm # target sequence database: /tmp/gapView.30674.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02017 [M=263] Accession: TIGR02017 Description: hutG_amidohyd: N-formylglutamate deformylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-120 385.6 0.0 6.6e-120 385.4 0.0 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057506765.1 ABB28_RS00615 N-formylglutamate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057506765.1 ABB28_RS00615 N-formylglutamate deformylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 385.4 0.0 6.6e-120 6.6e-120 2 262 .. 7 279 .. 6 280 .. 0.97 Alignments for each domain: == domain 1 score: 385.4 bits; conditional E-value: 6.6e-120 TIGR02017 2 alevqrGkaPllislPhtGtdltdavesrlvsaakalkdtdWhieklydfardlGatvvraaisrlvid 70 +lev++G+aPllis+PhtGt l+d+++ r+vs+++a++d+dW++++ly+far lGat+vr++isr+vid lcl|NCBI__GCF_001431535.1:WP_057506765.1 7 WLEVHEGDAPLLISFPHTGTALPDDLAGRFVSPWLARRDADWWVHELYAFARGLGATTVRSSISRSVID 75 99******************************************************************* PP TIGR02017 71 vnrdpsgaslypgqattgliPettfdgeplykdGeaPseaeikkrltkyfkPyhaalraeierlralhg 139 +nrdpsg+slypgq+ttgl+P ttfd++plyk ++P+eaei +r++ yf Pyhaal+++i+rlra hg lcl|NCBI__GCF_001431535.1:WP_057506765.1 76 LNRDPSGVSLYPGQNTTGLCPLTTFDNQPLYKPAQEPDEAEILRRREAYFAPYHAALASQIARLRARHG 144 ********************************************************************* PP TIGR02017 140 kivlydahsirsviPrlfeGklPdfnlGt.....ndgkscdpaladaveavcakakglssvlnGrfkGG 203 ++v+ydahsirs+iP+lf+G+lP+fnlGt + + scd+al+d ve++c+ +gl +v+nGrfkGG lcl|NCBI__GCF_001431535.1:WP_057506765.1 145 TVVVYDAHSIRSRIPHLFDGELPQFNLGTagptgEVDTSCDNALSDVVENLCR-LSGLPHVRNGRFKGG 212 ****************************9444334689**************9.*************** PP TIGR02017 204 yitrhygqPqngvhavqlelaqrgylee........etePvaydeakaealravlkellealldfae 262 +itrhy++ gvh++q+ela+rgy++e ++P++ d+++a++lr +l ++l+a+l+fa+ lcl|NCBI__GCF_001431535.1:WP_057506765.1 213 WITRHYSDIPGGVHSLQMELACRGYMAEpaaealdaHSWPTPLDDDHATPLRHTLAQVLTACLEFAS 279 **********************************9999***************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (284 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.11 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory