Align 3-ketoacyl-CoA thiolase [isoleucine degradation] (EC 2.3.1.16) (characterized)
to candidate WP_057508008.1 ABB28_RS07330 acetyl-CoA C-acyltransferase
Query= reanno::MR1:200842 (396 letters) >NCBI__GCF_001431535.1:WP_057508008.1 Length = 391 Score = 466 bits (1198), Expect = e-136 Identities = 238/387 (61%), Positives = 295/387 (76%) Query: 10 IVIVAAKRTPMGSFQGSLSGITSLSLAATAIKALLADTQVAPDKVDEVLMGCVLPAGLGQ 69 IVI AAKRT +GSF G +G+ + +L ATAI A L + V V EV+MGCVLPA LGQ Sbjct: 4 IVIAAAKRTAIGSFLGQFNGVPTPTLGATAIAAALEASGVPASDVTEVIMGCVLPANLGQ 63 Query: 70 APARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGGMESMSQAPY 129 APARQA + GLPLS GATT+NKVCGSGMK +ML HDLIKAGSA +V+AGGMESMS AP+ Sbjct: 64 APARQAAIAGGLPLSTGATTLNKVCGSGMKAIMLGHDLIKAGSASIVVAGGMESMSNAPH 123 Query: 130 LLDKARAGIRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEFGITREQMDAFALSSL 189 LL +R G R G+ + +DHM DGL +AY G AMG FA+ D++ +RE+ DA+A+ S+ Sbjct: 124 LLPNSRTGNRFGNFQAVDHMAHDGLVNAYDGKAMGEFAECAVDKYQFSREEQDAYAIESV 183 Query: 190 EKANAAINSGAFKTEIVPVTVSDRRGDVTIDTDEQPGNARPEKIPTLRPAFAKDGTITAA 249 ++A AA SGAF EIV V V+ R+G+V I DEQP A KIPTLRPAF KDG++TAA Sbjct: 184 KRAQAAQASGAFADEIVAVKVASRKGEVEISIDEQPTRADIAKIPTLRPAFKKDGSVTAA 243 Query: 250 NSSSISDGAAALMLTTRANAEQLGLTVLATIKGHTTHAQEPALFTTAPVGAMAKLLSNVG 309 +SSSISDGAAA++L + +A+ GL LA I H TH+QEP FTTAP+GA+ KLL G Sbjct: 244 SSSSISDGAAAVVLLSEEDAQARGLQPLARIVAHATHSQEPEWFTTAPIGAIHKLLDKAG 303 Query: 310 WSKDEVDLFEINEAFAMVTMLAVSELGLDMTKVNVNGGACALGHPIGCSGARLLVTLIHA 369 W+ +VDLFE+NEAFA+V M + ELG+ K+NVNGGACALGHPIG SGARL+VTL+HA Sbjct: 304 WTLADVDLFEVNEAFAVVAMAPMRELGIAHDKLNVNGGACALGHPIGASGARLVVTLVHA 363 Query: 370 LKARGLKRGVASLCIGGGEATAMAIEV 396 L++RG KRG+A+LCIGGGEATA+AIE+ Sbjct: 364 LRSRGGKRGIATLCIGGGEATAIAIEL 390 Lambda K H 0.316 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 503 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 391 Length adjustment: 31 Effective length of query: 365 Effective length of database: 360 Effective search space: 131400 Effective search space used: 131400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_057508008.1 ABB28_RS07330 (acetyl-CoA C-acyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.25830.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-128 412.3 10.6 1.2e-127 412.0 10.6 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057508008.1 ABB28_RS07330 acetyl-CoA C-acylt Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057508008.1 ABB28_RS07330 acetyl-CoA C-acyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 412.0 10.6 1.2e-127 1.2e-127 1 385 [] 6 389 .. 6 389 .. 0.98 Alignments for each domain: == domain 1 score: 412.0 bits; conditional E-value: 1.2e-127 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaag 69 i +a Rt+ig++ g+++ ++ +L+a++i ++le +g+ ++++ evi+G+vl+a+ ++++aR+aa+a g lcl|NCBI__GCF_001431535.1:WP_057508008.1 6 IAAAKRTAIGSFLGQFNGVPTPTLGATAIAAALEASGVPASDVTEVIMGCVLPANLGQAPARQAAIAGG 74 7899***************************************************************** PP TIGR01930 70 lpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakled 138 lp s+ a+t+n+vC+Sg++A++l+ + ikaG a++vvaGG+EsmS++p+ll++s r + ++g+++ d lcl|NCBI__GCF_001431535.1:WP_057508008.1 75 LPLSTGATTLNKVCGSGMKAIMLGHDLIKAGSASIVVAGGMESMSNAPHLLPNS--RTGNRFGNFQAVD 141 *****************************************************8..899********** PP TIGR01930 139 qllkdl...vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk..k 202 ++++d+ ++++ +mge Ae +ky++sReeqD+ya++S ++a++A+++g f+deiv v+v + + lcl|NCBI__GCF_001431535.1:WP_057508008.1 142 HMAHDGlvnAYDGKAMGEFAECAVDKYQFSREEQDAYAIESVKRAQAAQASGAFADEIVAVKVASRkgE 210 ******999999***************************************************999988 PP TIGR01930 203 kvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivs 271 + +s De++ + ++k+ +L+pafk+ +gs vtA++ss+++DGAaa++l see a++ gl+plariv+ lcl|NCBI__GCF_001431535.1:WP_057508008.1 211 VEISIDEQPT-RADIAKIPTLRPAFKK-DGS-VTAASSSSISDGAAAVVLLSEEDAQARGLQPLARIVA 276 8888888886.899***********95.9*7.************************************* PP TIGR01930 272 aavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiA 340 +a+ + +pe ++++p+ Ai+k+L+kag+++ d+dl+E+nEAFA++++a ++elg ++++k+NvnGGA A lcl|NCBI__GCF_001431535.1:WP_057508008.1 277 HATHSQEPEWFTTAPIGAIHKLLDKAGWTLADVDLFEVNEAFAVVAMAPMRELG-IAHDKLNVNGGACA 344 ******************************************************.77************ PP TIGR01930 341 lGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 lGHP+GasGar+v+tl+++L+ rg+k+G+atlC+ggG ++A+ +e lcl|NCBI__GCF_001431535.1:WP_057508008.1 345 LGHPIGASGARLVVTLVHALRSRGGKRGIATLCIGGGEATAIAIE 389 *****************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.48 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory