Align Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 (characterized)
to candidate WP_057509233.1 ABB28_RS14140 acetyl-CoA C-acyltransferase
Query= SwissProt::P14611 (393 letters) >NCBI__GCF_001431535.1:WP_057509233.1 Length = 426 Score = 191 bits (484), Expect = 4e-53 Identities = 142/429 (33%), Positives = 208/429 (48%), Gaps = 67/429 (15%) Query: 8 SAARTAVGKFGGSLAKIPAPELGAVVIKAALERAGVKPEQVSEVIMGQVLTAGSGQNPAR 67 + A + VG G S+ LGA+V ER G+ +Q+ EV MG V+ S N R Sbjct: 21 NTAYSDVGNLGMSVRT-----LGALV-----ERFGLHGQQLGEVAMGAVIKHSSDWNLGR 70 Query: 68 QAAIKAGLPAMVPAMTINKVCGSGLKAVMLAANAIMAGDAEIVVAGGQENMSAAPHV--- 124 +AA+ +GL + P +T+ + CG+ L ++ AN I G E + GG + S P V Sbjct: 71 EAALSSGLSPLTPGITMQRACGTSLDTIIAVANKIALGQIESGIGGGSDTTSDVPIVYGK 130 Query: 125 ------LPGSRD------------GFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENVAK 166 L +R GF+ + K G+ + MG E++AK Sbjct: 131 KLRARLLAANRAKSTGDKIRALTRGFKFSEFKPE----FPGVAEPRTGKSMGDHCEDMAK 186 Query: 167 EYGITREAQDEFAVGSQNKAEAAQKAGKFDEEIVPVLIPQRKGDPVAFKTDEFVRQGATL 226 E+ I+R++QDE+AV S K AA + G F++ I P +R D +R +L Sbjct: 187 EWNISRDSQDEWAVSSHRKLAAAYERGFFNDLIAPFRGVER---------DNILRADTSL 237 Query: 227 DSMSGLKPAFDKA---GTVTAANASGLNDGAAAVVVMSAAKAKELGLTPLATIKSYANAG 283 + ++ LKPAFDK GT+TAAN++ L DGA+AV++ S A+ G PLA ++ A Sbjct: 238 EKLATLKPAFDKVSGRGTLTAANSTPLTDGASAVLLASEEWARAHGHAPLAYLRDSQVAA 297 Query: 284 VD---PKVMGMGPVPASKRALSRAEWTPQDLDLMEINEAFAAQALAV----------HQQ 330 VD + + M P A L R T QD D+ EI+EAFAAQ L + Sbjct: 298 VDFVHGEGLLMAPTVAVPEMLKRNGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRNR 357 Query: 331 MGWDT-------SKVNVNGGAIAIGHPIGASGCRILVTLLHEMKRRDAKKGLASLCIGGG 383 +G D K+N G ++A GHP A+G R++ T ++ R + L S+C GG Sbjct: 358 LGLDAPLGRIDPEKINPLGSSLATGHPFAATGARVIATAAKQLAERGGGRALVSICTAGG 417 Query: 384 MGVALAVER 392 MGV VER Sbjct: 418 MGVVAIVER 426 Lambda K H 0.315 0.131 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 393 Length of database: 426 Length adjustment: 31 Effective length of query: 362 Effective length of database: 395 Effective search space: 142990 Effective search space used: 142990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory