Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate WP_057507300.1 ABB28_RS03505 3-hydroxyacyl-CoA dehydrogenase
Query= BRENDA::Q1D5Y4 (258 letters) >NCBI__GCF_001431535.1:WP_057507300.1 Length = 687 Score = 116 bits (290), Expect = 1e-30 Identities = 74/176 (42%), Positives = 105/176 (59%), Gaps = 8/176 (4%) Query: 24 NAISRAMLKELGELVTRVSSSRDVRAVVITGAGDKAFCAGADLKERATMAEDEVRAFLDG 83 NA+S+ +L ELG+L+ R++ + VVI A F AGADLKE D D Sbjct: 35 NAMSQDVLLELGDLIERIAIDPP-KGVVIQSAKKAGFIAGADLKEFQEF--DRRGTVNDA 91 Query: 84 LRR---TFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAA--PAAELGLTEVKLGII 138 +RR T++ + + C +AAI+G LGGGTELALAC RVA+ + +GL E +LGI Sbjct: 92 IRRGQVTYQKLAELPCPTVAAIHGHCLGGGTELALACRYRVASNDSSTRIGLPETQLGIF 151 Query: 139 PGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPEGHLLAVAYGLA 194 PG GG+ RL +LVG A D++LT R ++A+ A ++GL +++ LL A LA Sbjct: 152 PGWGGSARLPQLVGAPAAMDMMLTGRTLSASAARNIGLVDKVVAPALLLDTAVALA 207 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 687 Length adjustment: 31 Effective length of query: 227 Effective length of database: 656 Effective search space: 148912 Effective search space used: 148912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory