Align D-2-hydroxyglutarate dehydrogenase (EC 1.1.99.39) (characterized)
to candidate WP_057507800.1 ABB28_RS06140 dimethylmenaquinone methyltransferase
Query= BRENDA::Q8N465 (521 letters) >NCBI__GCF_001431535.1:WP_057507800.1 Length = 462 Score = 204 bits (519), Expect = 6e-57 Identities = 139/427 (32%), Positives = 218/427 (51%), Gaps = 30/427 (7%) Query: 106 PRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVSGI 165 P T E+V I+R C +AV +G TG G +VP+ ++LS ARM R+L + Sbjct: 49 PSTREQVQAIVRACRRHRVAVVARGAGTGTTGAAVPLQGSVVLSLARMARILEVRAGDRC 108 Query: 166 LVCQAGCVLEELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLG 225 V + G + +L + + P D + C IGGN+A NAGG R ++YG+ VLG Sbjct: 109 AVVEPGVLNGDLQQVLAPHGLFWPPDPSSADICSIGGNLACNAGGPRAVKYGTSRDNVLG 168 Query: 226 LEVVLADGTVLDCLTSLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKPRA---VNVA 282 L V G ++ C + KD TGYDL L +GSEGTL II ++ P A + V Sbjct: 169 LVAVTGSGDLIRCGGAYTKDATGYDLTHLLVGSEGTLAIIVEATLKLTPLAVAQAGLRVL 228 Query: 283 FLGCPGFAEVLQTFSTCKGMLGE--ILSAFEFMDAVCMQLVGRHLHLASPVQESPFYVLI 340 + A+ + ++G+ + + EFMDA ++L+ R+ + V ++ +LI Sbjct: 229 YRDADAAAQAVSR------VMGQPVVPTRLEFMDARSLELLRRN---GADVPDAGAMLLI 279 Query: 341 ETSGSNAGHDAEKLGHFLEHALGSGLVTDGTMATDQRKV----KMLWALRERITEALS-- 394 E G D + L + L+ AL + +G +A D + LWA R+ ++ AL Sbjct: 280 EADG-----DHDTLPYLLQ-ALANAAEGEGMIALDVAMEGAAREKLWAARKALSPALRSI 333 Query: 395 RDGYVYKYDLSLPVERLYDIVTDLRARLGPHAKHVVGYGHLGDGNLHLNV---TAEAFSP 451 G + + D+ +PV R+ ++V ++A +V +GH G+GNLH+N+ +A Sbjct: 334 APGKINE-DVVVPVSRIPELVRGVQALAAEFDLTIVTFGHAGNGNLHVNILYHPDDADEN 392 Query: 452 SLLAALEPHVYEWTAGQQGSVSAEHGVGFRKRDVLGYSKPPGALQLMQQLKALLDPKGIL 511 + A P ++ T +G++S EHG+G KRD + + P L M+ +KA LDP GIL Sbjct: 393 ARAQAALPRIFALTLALEGTLSGEHGIGLAKRDFMAQAFTPETLAAMRAIKAALDPDGIL 452 Query: 512 NPYKTLP 518 NP K LP Sbjct: 453 NPGKVLP 459 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 593 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 521 Length of database: 462 Length adjustment: 34 Effective length of query: 487 Effective length of database: 428 Effective search space: 208436 Effective search space used: 208436 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory