Align Inositol 2-dehydrogenase; EC 1.1.1.18; Myo-inositol 2-dehydrogenase; MI 2-dehydrogenase (uncharacterized)
to candidate WP_057509063.1 ABB28_RS13215 gfo/Idh/MocA family oxidoreductase
Query= curated2:A0LVX1 (341 letters) >NCBI__GCF_001431535.1:WP_057509063.1 Length = 374 Score = 74.7 bits (182), Expect = 3e-18 Identities = 68/223 (30%), Positives = 92/223 (41%), Gaps = 24/223 (10%) Query: 9 IGLIGAGAIGEDHARRLSTVIRGADVVAVHDVDPSRAKTVATRFRDARVIPDGNSLIGDP 68 I ++G G IG H R + ++ GA V V RA+ VA + R D + ++ DP Sbjct: 6 IAIVGTGMIGAVHRR--AALLAGAAVRGVAASSAQRAREVAQSWNLPRAYRDLDEVLADP 63 Query: 69 DVDAVVVASAAPTHEAYVLAAIAARKPVFCEKPLATTAAGCLRIVEAEKAHGRRFVRVGF 128 V V V + H AA+ A K V CEKPLATT + A G R V F Sbjct: 64 QVQVVHVCTPNHLHRGMAQAALEAGKHVICEKPLATTLEDAKALAALAAARG-RVATVPF 122 Query: 129 MRRFDPAYLGLKAELRSGAIGHPLLAHLAH--------RNPAV------PSTLRTTDAIA 174 + R+ P +A + G +G PL HL H +PA P+ + A Sbjct: 123 VYRYHPVVREARARIAQGELG-PL--HLIHGSYLQDWLLDPASNNWRVDPALGGASRVFA 179 Query: 175 DSLVHEMDLVRWLFDTEIREVRA----VAGRRNAKAGPDLHDP 213 D H DLV W+ +V A V R A +G P Sbjct: 180 DIGSHWCDLVEWVGGERFIDVSAAFATVIDERGAPSGQSFSTP 222 Lambda K H 0.320 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 374 Length adjustment: 29 Effective length of query: 312 Effective length of database: 345 Effective search space: 107640 Effective search space used: 107640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory