Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate WP_057509233.1 ABB28_RS14140 acetyl-CoA C-acyltransferase
Query= metacyc::MONOMER-15952 (401 letters) >NCBI__GCF_001431535.1:WP_057509233.1 Length = 426 Score = 177 bits (450), Expect = 4e-49 Identities = 144/431 (33%), Positives = 213/431 (49%), Gaps = 49/431 (11%) Query: 6 IIDAVRTPIGRYAGALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCANQAGEDNR 65 I+ VR P R A + V + L AL+ R L + +V G + D Sbjct: 9 ILGGVRIPFCRQNTAYSDVGNLGMSVRTLGALVERFG-LHGQQLGEVAMGAVIKHSSD-W 66 Query: 66 NVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESMSRAPF 125 N+ R AAL +GL PG T+ R CG+ LD + + A + G+ + GG ++ S P Sbjct: 67 NLGREAALSSGLSPLTPGITMQRACGTSLDTIIAVANKIALGQIESGIGGGSDTTSDVPI 126 Query: 126 VMGK--------SEQAFGRSAEIFDTTIGWRFVNKLMQQGFGI------DSMPETAENVA 171 V GK + +A +I T G++F ++ + G+ SM + E++A Sbjct: 127 VYGKKLRARLLAANRAKSTGDKIRALTRGFKF-SEFKPEFPGVAEPRTGKSMGDHCEDMA 185 Query: 172 AQFNISRADQDAFALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTT 231 ++NISR QD +A+ S K AAA G +++A P + VE D R DT+ Sbjct: 186 KEWNISRDSQDEWAVSSHRKLAAAYERG-FFNDLIA--------PFRGVERDNILRADTS 236 Query: 232 LEQLAKLGTPFRQ---GGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATA 288 LE+LA L F + G++TA N++ + DGA A+LLAS E A+ HG A + A Sbjct: 237 LEKLATLKPAFDKVSGRGTLTAANSTPLTDGASAVLLASEEWARAHGHAPLAYLRDSQVA 296 Query: 289 GVEPRIMGIG----PVPATRKVLELTGLALADMDVIELNEAFAAQGLAVLR--------- 335 V+ + G G P A ++L+ GL L D D+ E++EAFAAQ L LR Sbjct: 297 AVD-FVHGEGLLMAPTVAVPEMLKRNGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR 355 Query: 336 -ELGLAD-----DDERVNPNGGAIALGHPLGMSGARLVTTALHELEERQGRYALCTMCIG 389 LGL D E++NP G ++A GHP +GAR++ TA +L ER G AL ++C Sbjct: 356 NRLGLDAPLGRIDPEKINPLGSSLATGHPFAATGARVIATAAKQLAERGGGRALVSICTA 415 Query: 390 VGQGIALIIER 400 G G+ I+ER Sbjct: 416 GGMGVVAIVER 426 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 426 Length adjustment: 31 Effective length of query: 370 Effective length of database: 395 Effective search space: 146150 Effective search space used: 146150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory