Align spermidine/putrescine ABC transporter, permease protein PotB (characterized)
to candidate WP_057507677.1 ABB28_RS05545 molybdate ABC transporter permease subunit
Query= CharProtDB::CH_088337 (275 letters) >NCBI__GCF_001431535.1:WP_057507677.1 Length = 227 Score = 79.3 bits (194), Expect = 7e-20 Identities = 58/172 (33%), Positives = 83/172 (48%), Gaps = 4/172 (2%) Query: 50 LYFEVLLHSLNMALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRIYG 109 L + L+ SL +A AT LVLG W LA+ R LL LL +P + Y Sbjct: 3 LDWSALVLSLKVAGWATAINLVLGVALGWLLARRRFPGRELLDTLLTLPMVLPPTVLGYY 62 Query: 110 LKIFLSTKGYLNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKP 169 L + + G L +L I ++FT A +I LP + P ++ E +D Sbjct: 63 LLVLIGRNGPLGGWLQ----SSFGINLVFTWQAAVIAAAVAALPLVFKPARAAFEGVDGQ 118 Query: 170 LLEAARDLGASKLQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGGA 221 L +AAR LGA++ F RI +PL GI+AG LL AMG F + ++ G+ Sbjct: 119 LEQAARTLGATEAAVFFRITLPLAWRGILAGLLLAFARAMGEFGATLMVAGS 170 Lambda K H 0.333 0.148 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 227 Length adjustment: 24 Effective length of query: 251 Effective length of database: 203 Effective search space: 50953 Effective search space used: 50953 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory