Align 2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29) (characterized)
to candidate WP_057508531.1 ABB28_RS10250 8-amino-7-oxononanoate synthase
Query= reanno::Koxy:BWI76_RS27255 (397 letters) >NCBI__GCF_001431535.1:WP_057508531.1 Length = 404 Score = 164 bits (415), Expect = 4e-45 Identities = 112/355 (31%), Positives = 176/355 (49%), Gaps = 6/355 (1%) Query: 36 ITVGGSQVINFCANNYLGLANHPELIAAAKSGMDSHGFGMASVRFICGTQDSHKALEKKL 95 + V G + +F ++YLGLA ++ A + + G + G H+ALE + Sbjct: 37 VEVDGHTLTSFRGSDYLGLAQQFGVVNALQDAVAREGVNGGAAPAAGGRHALHQALEAEA 96 Query: 96 ADFLGMEDAILYSSCFDANGGLFETLLGAE-DAIISDALNHASIIDGVRLCKAKRFRYAN 154 A++LG A+L+SS + AN + + LL + D D LNH S++D L A+ RY + Sbjct: 97 AEWLGHPRALLFSSAYLANLAVQQVLLCEDGDVCAQDQLNHPSLLDATALAGARLRRYPH 156 Query: 155 NDMVELEARLKEARDAGARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAV 214 D +LK A + A ++ATD VF +DG A L+ + +A AL+ VDD+H + Sbjct: 157 LDTEGAMRQLKHAAEGAA---MLATDAVFCIDGDSAPLRSLTLVARMQQALLCVDDTHGI 213 Query: 215 GFVGENGRGSHEYCDV-MGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFS 273 G +G+ GRGS + V + L ALGG SG ++E L +RPYL+S Sbjct: 214 GVLGDGGRGSVSAAGLGTAEVPLQVFALDAALGG-SGALVVGDAALLEHLAATARPYLYS 272 Query: 274 NSLAPAIVAASIKVLEMVEAGSELRDRLWSNARLFREKMTAAGFILAGADHAIIPVMLGE 333 +L+PA+ AAS++ L + R++L +FR G L A+ I + Sbjct: 273 PALSPALAAASLEALRLARRDDWRREKLVELVGVFRSAARGHGLGLMAAETPIQSLSFAT 332 Query: 334 ATVAQEFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQIERAVEAFTR 388 A A+ LQ+ G++V + G AR+R +SA H P Q++ V+A R Sbjct: 333 DQQAMALAQNLQQAGMWVGTVAAGLTGDGAARVRVSLSALHVPAQVQALVDAIAR 387 Lambda K H 0.321 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 404 Length adjustment: 31 Effective length of query: 366 Effective length of database: 373 Effective search space: 136518 Effective search space used: 136518 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory