Align 2-methylbutanoyl-CoA dehydrogenase / butanoyl-CoA dehydrogenase / isobutyryl-CoA dehydrogenase (EC 1.3.8.1; EC 1.3.8.5) (characterized)
to candidate WP_057507594.1 ABB28_RS05080 isovaleryl-CoA dehydrogenase
Query= reanno::pseudo3_N2E3:AO353_25680 (375 letters) >NCBI__GCF_001431535.1:WP_057507594.1 Length = 387 Score = 274 bits (701), Expect = 3e-78 Identities = 141/366 (38%), Positives = 218/366 (59%) Query: 10 ISDAARQFAQERLKPFAAEWDREHRFPKEAIGEMAELGFFGMLVPEQWGGCDTGYLAYAM 69 + D+ QFA + P AA D ++FP ++ E G GM V E++GG GYLA+ + Sbjct: 17 LRDSVAQFAAAEIAPLAAHADETNQFPLALWRKLGEQGLLGMTVEEEYGGTGMGYLAHVV 76 Query: 70 ALEEIAAGDGACSTIMSVHNSVGCVPILKFGNDDQKERFLKPLASGAMLGAFALTEPQAG 129 A+EE++ G H+++ + K G QK+RFL L SG ++GA A++EP AG Sbjct: 77 AMEEVSRASGGIGLSYGAHSNLCVNQLRKNGTQAQKQRFLPGLCSGELVGALAMSEPGAG 136 Query: 130 SDASSLKTRARLNGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGISAFIVPTDSP 189 SD S+K RA GD YVLNG K +IT+G +A V++V+A TDP AG +GI+AF+V Sbjct: 137 SDVVSMKLRAEKRGDRYVLNGNKMWITNGPDADVLVVYAKTDPDAGAKGITAFLVEKGMK 196 Query: 190 GYKVARVEDKLGQHASDTCQILFEDVQVPVANRLGEEGEGYKIALANLEGGRVGIASQSV 249 G+ A+ DKLG +S T +++F+D +VP N LG+EG G ++ ++ L+ RV ++ + Sbjct: 197 GFSTAQKLDKLGMRSSPTSELVFQDCEVPAENVLGQEGSGVRVLMSGLDYERVVLSGGPL 256 Query: 250 GMARAAFEAARDYARERESFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAALRDSGKP 309 G+ AA + Y ER FG+ I Q + ++ADM + R V+ A D G+ Sbjct: 257 GLMAAAMDVVMPYVHERHQFGEAIGSFQLIQAKIADMYVGLGACRAYVYAVARACDQGRT 316 Query: 310 ALVEASMAKLFASEMAEKVCSTALQTLGGYGYLSDFPLERIYRDVRVCQIYEGTSDIQRM 369 +A+ A L+A+E A + A+Q LGG GY++++P R++RD ++ +I GTS+I+RM Sbjct: 317 TRQDAAGAILYAAEKATWLTGQAIQILGGNGYINEYPTGRLWRDAKLYEIGAGTSEIRRM 376 Query: 370 VISRNL 375 +I R L Sbjct: 377 LIGREL 382 Lambda K H 0.319 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 23 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 387 Length adjustment: 30 Effective length of query: 345 Effective length of database: 357 Effective search space: 123165 Effective search space used: 123165 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory