Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_057508430.1 ABB28_RS09665 NAD(P)-dependent alcohol dehydrogenase
Query= BRENDA::P35497 (357 letters) >NCBI__GCF_001431535.1:WP_057508430.1 Length = 350 Score = 60.1 bits (144), Expect = 9e-14 Identities = 60/194 (30%), Positives = 86/194 (44%), Gaps = 14/194 (7%) Query: 33 VKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRVAI 92 V++ I +GIC SD+H R G K PMV GHE G+VVEVG VT++KVGD + Sbjct: 31 VRIEILYSGICHSDLHQARDDWGGA---KYPMVPGHEIIGKVVEVGAEVTKLKVGDFAGV 87 Query: 93 EPGVPS-RYSDETKEGRYNLCPH---MAFAAT-----PPIDGTLVKYYLSPEDFLVKLPE 143 V S R+ + C + T P G + + + F+VK+ E Sbjct: 88 GCMVDSCRHCEACNADLEQYCAEGSTFTYNGTDRHTGEPTQGGYSDHIVVEQRFVVKVSE 147 Query: 144 GVSYEEGACVEPLSVGVHSN-KLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVD 202 + + A + + +S K V G KV V G G +G + A+A GA V+ + Sbjct: 148 TLDLKAAAPLLCAGITTYSPLKHFKVGPGQKVGVIGLGGLGHMGVKFAKALGA-HVVMIT 206 Query: 203 VFDNKLQRAKDFGA 216 K A GA Sbjct: 207 TTPEKGADATRLGA 220 Lambda K H 0.318 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 350 Length adjustment: 29 Effective length of query: 328 Effective length of database: 321 Effective search space: 105288 Effective search space used: 105288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory