GapMind for catabolism of small carbon sources

 

Protein WP_086511012.1 in Halomonas desiderata SP1

Annotation: NCBI__GCF_002151265.1:WP_086511012.1

Length: 346 amino acids

Source: GCF_002151265.1 in NCBI

Candidate for 26 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-mannitol catabolism mtlK hi SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 62% 100% 407.9 ABC transporter for D-Sorbitol, ATPase component 60% 389.0
D-sorbitol (glucitol) catabolism mtlK hi ABC transporter for D-Sorbitol, ATPase component (characterized) 60% 100% 389 N-Acetyl-D-glucosamine ABC transport system, ATPase component 59% 369.4
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 59% 94% 369.4 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 59% 94% 369.4 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 56% 100% 350.9 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
D-maltose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 55% 97% 345.9 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
sucrose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 55% 97% 345.9 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
trehalose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 55% 97% 345.9 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 50% 99% 313.2 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 48% 100% 308.1 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
D-maltose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 50% 99% 300.8 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
sucrose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 50% 99% 300.8 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
trehalose catabolism aglK med ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 50% 99% 300.8 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 47% 100% 297.7 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
D-cellobiose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 47% 97% 297.4 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
D-glucose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 47% 97% 297.4 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
lactose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 47% 97% 297.4 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
D-maltose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 47% 97% 297.4 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
sucrose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 47% 97% 297.4 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
trehalose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 47% 97% 297.4 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
L-arabinose catabolism xacK med Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 45% 99% 289.7 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 49% 95% 288.5 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
L-arabinose catabolism xacJ med Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 49% 83% 266.2 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 48% 86% 253.4 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 61% 69% 310.5 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9
glycerol catabolism glpT lo ABC transporter for Glycerol, ATPase component 2 (characterized) 39% 89% 200.3 SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter 62% 407.9

Sequence Analysis Tools

View WP_086511012.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MADVTLVDIEKTFRGKTTVIPNLNLRIEDGSFTVLVGPSGCGKSTLLRMIAGLETVTRGA
ISIGGRDVTTAEPSERNIAMVFQSYALYPHMTVARNIDFGMRLAKVPTEERMAKVAEAAR
LLNLEELLERKPAELSGGQRQRVAIGRAIVRNPGVFLFDEPLSNLDAALRNRMRVELAEL
HQRLDATMIYVTHDQVEAMTLADCIVVMNAGQIEQVGTPMNLYQRPETLFVAGFIGSPKM
NLIEGEVAKAHGATTLGIRPEHLEVSHEAGEWRTRVRVVEMLGADAFAYVDSDATGPLTV
RLPGDAEVRSGDILYLTPRYELLHAFGIDGRRLPDEALARPRATMA

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory