Align FcbT2, component of Tripartite 4-chlorobenzoate symporter (also binds and may transport 4-bromo-, 4-iodo-, and 4-fluorobenzoate and with a lower affinity, 3-chlorobenzoate, 2-chlorobenzoate, 4-hydroxybenzoate, 3-hydroxybenzoate, and benzoate) (characterized)
to candidate WP_086510894.1 BZY95_RS15995 TRAP transporter small permease
Query= TCDB::Q9RBR0 (181 letters) >NCBI__GCF_002151265.1:WP_086510894.1 Length = 152 Score = 86.3 bits (212), Expect = 2e-22 Identities = 54/147 (36%), Positives = 81/147 (55%), Gaps = 11/147 (7%) Query: 29 ACGLVLLMVLVICADVTLRATMRSGLTSASAV-----AEYSLYAITFLAAPLLLRKGQHI 83 ACGL +++ + + V + M L S +EY++ A TFLAAP +L G H+ Sbjct: 4 ACGLAAGLIIGVVSVVIVLNVMSRNLGFGSIYGTVEGSEYAIAAATFLAAPWVLYHGAHV 63 Query: 84 RVDLVLRAMPPRAAWLLEWAVDACGAAIS---GLFLTSSVHVLVQSYSQSAMVMREMMFP 140 RVDL+ +A+P LE A++ GA+IS G FL S+ S+ MV + +FP Sbjct: 64 RVDLLQQALPKAPRRWLEMAINLLGASISLCFGYFLLSTGS---DYLSRGTMVYKSFVFP 120 Query: 141 EWWLYIPMPISLALLTIEFLLRMRRLV 167 EWW ++ + LLT+EFL R+ RL+ Sbjct: 121 EWWNFVLPSLCFGLLTLEFLRRLWRLI 147 Lambda K H 0.327 0.134 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 85 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 181 Length of database: 152 Length adjustment: 18 Effective length of query: 163 Effective length of database: 134 Effective search space: 21842 Effective search space used: 21842 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory