Align FcbT3, component of Tripartite 4-chlorobenzoate symporter (also binds and may transport 4-bromo-, 4-iodo-, and 4-fluorobenzoate and with a lower affinity, 3-chlorobenzoate, 2-chlorobenzoate, 4-hydroxybenzoate, 3-hydroxybenzoate, and benzoate) (characterized)
to candidate WP_086508299.1 BZY95_RS01820 TRAP transporter large permease
Query= TCDB::Q9RBQ9 (439 letters) >NCBI__GCF_002151265.1:WP_086508299.1 Length = 437 Score = 389 bits (998), Expect = e-112 Identities = 185/433 (42%), Positives = 295/433 (68%) Query: 1 MNWQLAAWLLLGGTTVLLFLGLPVAYSFFAINVVGAWLFLGGDSALGQLVRNGLVAVASF 60 M W LA LL + +G P+A +F A NV+GAW F+GG + L QL+ NG A++SF Sbjct: 1 MEWYLALAFLLALILGFMAIGTPIALAFLAANVIGAWHFMGGQNGLIQLLNNGFGALSSF 60 Query: 61 SLTPIPLFILMGELLFHTGLAQRAIDGIDKVIPRLPGRLAVIAVVAGTFFSAISGSTIAT 120 +L PIPLF+LMGEL F TGL R + ID+++ ++PGRL+ + VV GT FS +SGS++ + Sbjct: 61 NLVPIPLFLLMGELFFRTGLGMRMFNAIDQLMGKVPGRLSYVTVVGGTGFSTLSGSSMGS 120 Query: 121 TAMLGSLMLPMMLARGYEPKLGMGPIIAIGGVDMLIPPSALAVLLGSLAGISISKLLIGG 180 TA++GSL++P M RGY+ ++ +GPI+ GG+ ++IPPSALAVLL +LA + I LLI G Sbjct: 121 TALMGSLLVPEMERRGYQKRMAIGPILGTGGLAIIIPPSALAVLLATLAKVDIGALLIAG 180 Query: 181 VLPGLLLAISFVAYIVASAKLRPESAPREELVVLRGWERWRELVVYVLPLSLIFVAIVAV 240 +LPGLLLA ++ I +L P++AP EL + ++ + ++ +LP+ + + IVA+ Sbjct: 181 ILPGLLLAGLYIGTIWIQTRLDPDAAPNYELEPVPLGQKLKLVLTDILPMISVMIFIVAL 240 Query: 241 ISGGVATPTEAAAIGCAATLAITLMYRALRWQSLVQALQGTVAISGMILFIIVAATTFSQ 300 + G ATP+EAAA G + + L++R + W++ ++ G + ++ M I+ + TFSQ Sbjct: 241 MLLGFATPSEAAAFGALGAIVLALIFRCMTWEAFKLSVIGALKVTLMAYLIVFGSATFSQ 300 Query: 301 VLSFSGATNGIVDLVQSSGLPPAGVVAIMLAILIFLGLFVDQVSMMLLTLPFYMPIVKSL 360 +L+FSGA++G++ S L P ++ M A+L+ LG F++Q+S+M+LT+PF+ P+ + L Sbjct: 301 LLAFSGASSGLIQWATSFDLAPILMLLAMFAVLLVLGTFMEQISIMMLTVPFFFPLAQVL 360 Query: 361 GIDQIWFGVMYLICMQLGLLMPPHGMLLYTMKGVAPKHITMGQVFASAMPYVGLSFTMLI 420 G D IWFG++ L+ +++ PP G+LL+ MKGVAPK TM +++++A+PY+ S ++ Sbjct: 361 GFDPIWFGIIMLLALEISFSTPPLGLLLFVMKGVAPKGTTMREIYSAAIPYILCSMLLVA 420 Query: 421 LIFFWPGIATWLP 433 ++ +PGIATWLP Sbjct: 421 ILVVFPGIATWLP 433 Lambda K H 0.329 0.143 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 548 Number of extensions: 29 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 437 Length adjustment: 32 Effective length of query: 407 Effective length of database: 405 Effective search space: 164835 Effective search space used: 164835 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory