GapMind for catabolism of small carbon sources

 

Alignments for a candidate for pcaC in Halomonas desiderata SP1

Align 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) (characterized)
to candidate WP_086508611.1 BZY95_RS03565 carboxymuconolactone decarboxylase

Query= BRENDA::Q6SJC5
         (136 letters)



>NCBI__GCF_002151265.1:WP_086508611.1
          Length = 399

 Score =  117 bits (293), Expect = 2e-31
 Identities = 55/113 (48%), Positives = 79/113 (69%), Gaps = 1/113 (0%)

Query: 15  YTTGMDTRRRVLGDAHVDRAEACKSDFDAPFQTLITEGAWGTVWASDAISPRERSMLTLA 74
           Y  G++TR++VLG+ HV RA    +  DAPFQ +IT  AWG +W++D ++ RERS++T  
Sbjct: 280 YADGLETRKQVLGEEHVARASRNANSLDAPFQQMITRLAWGELWSNDDLTRRERSLITTG 339

Query: 75  LLAATGNFEEIPMHIRATARTGASQSDVIEAFQHVAIYAGVPRANHAIRLAKE 127
           +LAA G  EE+ +H++   R G S++++ +   HVAIYAGVP ANHA  LAKE
Sbjct: 340 ILAALGR-EELVLHLKTAKRIGLSEAELRQVLMHVAIYAGVPAANHAFALAKE 391


Lambda     K      H
   0.317    0.128    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 159
Number of extensions: 5
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 136
Length of database: 399
Length adjustment: 23
Effective length of query: 113
Effective length of database: 376
Effective search space:    42488
Effective search space used:    42488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 46 (22.3 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory