Align protocatechuate 3,4-dioxygenase (EC 1.13.11.3) (characterized)
to candidate WP_086508606.1 BZY95_RS03540 protocatechuate 3,4-dioxygenase subunit beta
Query= BRENDA::A8I4B3 (246 letters) >NCBI__GCF_002151265.1:WP_086508606.1 Length = 246 Score = 433 bits (1113), Expect = e-126 Identities = 200/245 (81%), Positives = 219/245 (89%), Gaps = 2/245 (0%) Query: 3 RNDNKRFVERDRNWHPPAYAPGYKTTVARSPSQAYVSMQAPSVSELGGPDFTRLRMGPHD 62 ++ NKRFVERDRNWHPPAYAPGYKT+V RSP QA SMQ + SEL GPDF LRMGPHD Sbjct: 2 QDHNKRFVERDRNWHPPAYAPGYKTSVPRSPQQALASMQQATASELTGPDFRHLRMGPHD 61 Query: 63 NDLLLNFRADNEAQ--AGLPIGERVIVFGRVVDQFGKPVPNTLVEMWQANAGGRYRHKKD 120 NDLLLNFR D AGLP+GER+I+FGRV+DQFGKPVP+TLVEMWQANAGGRYRHK D Sbjct: 62 NDLLLNFREDPSLSGAAGLPVGERIIMFGRVIDQFGKPVPHTLVEMWQANAGGRYRHKND 121 Query: 121 GYLAPLDPNFGGVGRCLSDDEGWYRFRTIKPGPYPWPNDINSWRPAHIHVSVMGPSISTR 180 YLAPLDP FGGVGR L+D++GWYRFRTIKPGPYPWPND NSWRP+HIHVSVMGPSISTR Sbjct: 122 RYLAPLDPGFGGVGRTLTDEQGWYRFRTIKPGPYPWPNDPNSWRPSHIHVSVMGPSISTR 181 Query: 181 LITQMYFEGDPLIPLCPIVHTLRDPEAVETMTGRLDMARSRSMDCLAYRFDLVIRGEVQT 240 LITQMYFEGDPLIPLCPIVHT++DP AVETM GRLDMARS+ MDCLAYRFDLV+RGE+QT Sbjct: 182 LITQMYFEGDPLIPLCPIVHTIKDPAAVETMIGRLDMARSKPMDCLAYRFDLVVRGELQT 241 Query: 241 YFENQ 245 +FENQ Sbjct: 242 FFENQ 246 Lambda K H 0.321 0.140 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 246 Length of database: 246 Length adjustment: 24 Effective length of query: 222 Effective length of database: 222 Effective search space: 49284 Effective search space used: 49284 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory