Align D-lactate oxidase, FAD-linked subunit (EC 1.1.3.15) (characterized)
to candidate WP_086511807.1 BZY95_RS20845 FAD-binding oxidoreductase
Query= reanno::Smeli:SMc00832 (479 letters) >NCBI__GCF_002151265.1:WP_086511807.1 Length = 479 Score = 182 bits (462), Expect = 2e-50 Identities = 152/481 (31%), Positives = 225/481 (46%), Gaps = 29/481 (6%) Query: 20 EIVADLADLLPEGGLISDERGLKPFETDAFIAYRRMPLAVVLPETTEHVAAVLKYCSRYG 79 + VA LL G+I+ + + D A MPLAVV P TTE VAAV+ YC R G Sbjct: 6 DAVAAFTQLLGANGVITAAADQERYVRDWAGARLGMPLAVVRPRTTEEVAAVVGYCHRNG 65 Query: 80 IPIVPRGAGTSLSGGAIPQEDA--IVVGLSKMSRTLDIDLFNRTATVQAGVTNLNISDAV 137 I +V +G T L GA+P +V+ L +M+R +D N + V G + A Sbjct: 66 IRMVAQGGHTGLVKGALPDSRTPEVVISLERMTRIRGLDPLNFSMAVDGGCILEEVKRAA 125 Query: 138 SADGFFYAPDPSSQLACTIGGNIGMNSGGAHCLKYGVTTNNLLGVKMVLFDGTVIELGGK 197 F+ +Q +C IGGNI N+GG + L+YG+ +LG+++VL DG + G K Sbjct: 126 EEADCFFPLSLGAQGSCQIGGNIATNAGGVNVLRYGMMRELVLGLEVVLPDGEIWN-GMK 184 Query: 198 AL--DAPGYDLLGLVCGSEGQLGIVTEATVRLIAKPEGARPVLFGFASSESAGSCVA--- 252 AL D GYDL L GSEG LGIVT A ++L +PE ++ L S E+A A Sbjct: 185 ALHKDNRGYDLKQLFLGSEGTLGIVTGAVLKLTPRPEQSQTALLAVPSVEAAVRLYALAR 244 Query: 253 ----DIIGSGIIPVAIEFMDRPAIEIC-EAFAQAGYPLD----VEALLIVEVEGSEAEMD 303 D++ A E M R +E+ EA Q P D LL + G ++ Sbjct: 245 RRCSDLLS------AFELMPRLCLELAFEAAPQLADPFDEAYPYHVLLELTATG-PVDLS 297 Query: 304 ATLAGIIEIARRHGVMTIRE-SQSALEAALIWKGRKSAFGATGRIADYICMDGTVPLSQL 362 L G++E H V+ + S +A +W R+S +++ D +VP+S + Sbjct: 298 GLLEGLLEAGMEHEVVLDGVLASSVAQAGQLWAIRESMVEGQLLRGEHLRTDVSVPISAI 357 Query: 363 SH-VLRRTGEIVA-GYGLRVANVFHAGDGNMHPLILYNINDPEEAARA--EAAGNDILKL 418 + V + T E+ A +V H GDGN+H +L P EA A E I + Sbjct: 358 AECVEQATAEVAALSPTSQVIAYGHIGDGNLHINVLPPAETPAEALPALFERLERAIFTV 417 Query: 419 CVEAGGCLTGEHGVGIEKRDLMLHQYSRADLGQQMAARAAFDPQWLMNPSKVFPLEGRPA 478 G ++ EHG+G K+ L + + + +A FDP LM ++ P R + Sbjct: 418 VDGFDGSISAEHGIGRSKQAAFLDRLTVTERRLLAGIKAVFDPDDLMGAGRIQPASKRSS 477 Query: 479 A 479 + Sbjct: 478 S 478 Lambda K H 0.320 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 598 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 479 Length adjustment: 34 Effective length of query: 445 Effective length of database: 445 Effective search space: 198025 Effective search space used: 198025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory