Align Putative L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE (characterized, see rationale)
to candidate WP_086511826.1 BZY95_RS20935 (Fe-S)-binding protein
Query= uniprot:A0A0C4YIN5 (262 letters) >NCBI__GCF_002151265.1:WP_086511826.1 Length = 251 Score = 296 bits (758), Expect = 3e-85 Identities = 141/249 (56%), Positives = 182/249 (73%), Gaps = 5/249 (2%) Query: 6 YPPAPAQVYLFATCLVDMFVPQAGLDAVRLLEREGLTVHFPRGQSCCGQPAYSSGNPEQA 65 YPP P +VY F TCL+D+F P+AG+D +RLLEREG+ V +P+ Q+CCGQPAY+SG ++A Sbjct: 7 YPPKPEKVYFFGTCLIDLFYPEAGMDGIRLLEREGIEVVYPQAQTCCGQPAYTSGYHDEA 66 Query: 66 RAVALAQLDLFAEPWPVIVPSGSCAGMMRHHWPQLFAQDPVAGPKAALLAERVYELSEFL 125 RAVA AQLDLF EPWP++VPSGSC GMMR H+PQLFA +A +A R+YEL+EFL Sbjct: 67 RAVAAAQLDLFPEPWPIVVPSGSCGGMMRTHYPQLFAGTEHEA-RANEVAGRIYELTEFL 125 Query: 126 LHVLKVRFDVSGVAGQPPETVVLHTSCAARREMGTRDHGVALVDALPGVTRTEHQRESEC 185 LHV ++R + G PE V +HTSC+ARREMG + G AL+ + V E R +EC Sbjct: 126 LHVCQLRLEDRG----QPEKVAMHTSCSARREMGLGETGPALLARMGQVELVEQARATEC 181 Query: 186 CGFGGTFSLKHPDISGAMVQDKIASACATGCDRLVSADCGCLLNIGHAARHQGAPLPVEH 245 CGFGGTF+++HP++S AMV+DK + ATG R V++DCGCL+NI HQG + EH Sbjct: 182 CGFGGTFAVRHPEVSAAMVEDKTQAIEATGARRFVTSDCGCLMNIAGRFEHQGKAVSGEH 241 Query: 246 IASFLWRRT 254 IAS+LWRRT Sbjct: 242 IASYLWRRT 250 Lambda K H 0.323 0.136 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 251 Length adjustment: 24 Effective length of query: 238 Effective length of database: 227 Effective search space: 54026 Effective search space used: 54026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory