Align L-arabonate dehydratase (EC 4.2.1.25) (characterized)
to candidate WP_086509434.1 BZY95_RS08080 dihydroxy-acid dehydratase
Query= reanno::Smeli:SM_b20890 (579 letters) >NCBI__GCF_002151265.1:WP_086509434.1 Length = 614 Score = 268 bits (685), Expect = 5e-76 Identities = 189/568 (33%), Positives = 293/568 (51%), Gaps = 64/568 (11%) Query: 21 GKNAIMHRSWMKNQGLPADTFDGRPIIGICNTWSELTPCNAHLRDLAERVKRGVYEAGGF 80 G+N R+ + G+ + F +PII + N++++ P + HL+D+ + V R + +AGG Sbjct: 12 GRNMAGARALWRATGMKDEDFH-KPIIAVANSFTQFVPGHVHLKDMGQLVAREIEKAGGV 70 Query: 81 PVEFPVFSTGES-TLRPTAMMF----RNLAAMDVEESIRGNPVDGVVLLGGCDKTTPSLL 135 EF + + + M++ R++ A VE + + D +V + CDK TP +L Sbjct: 71 AKEFNTIAVDDGIAMGHDGMLYSLPSRDIIADSVEYMVNAHCADALVCISNCDKITPGML 130 Query: 136 MGAASVDIPAIVVSGGPMLNGKWRGKDVGSGTAIWQFSEMVKSGEMSLEE--FMDAEQGM 193 M A ++IP I VSGGPM GK + D G MV + + S+++ + E+ Sbjct: 131 MAAMRLNIPVIFVSGGPMEAGKTKLLDHGLDLV----DAMVMAADDSVDDETLAEVERSA 186 Query: 194 ARSAGSCMTMGTASTMASMAEALGMTLSGNAAIPAVDARRRVISQLTGRRIVEMVKE--- 250 + GSC M TA++M + EALG+ L GN + A A RR + + G RIVE+ K Sbjct: 187 CPTCGSCSGMFTANSMNCLTEALGLALPGNGTVLATHADRRRLFETAGHRIVELAKRYYE 246 Query: 251 ----DLKPSDILTKEAFENAIRVNGAVGGSTNAVLHLLALAGRVGVDLSLDDWDRLGRDV 306 L P I +K AF+NA+ ++ A+GGSTN +LHLLA A +D ++ D DRL R+V Sbjct: 247 GDEAHLLPRAIGSKAAFKNAMTLDIAMGGSTNTILHLLAAAQEAEIDFTMADIDRLSREV 306 Query: 307 PTIVNLQP-SGKYLMEEFYYAGGLPVVIKAVAEMGLLHNDAITVSGDTI------WNDVK 359 P + + P + KY +E+ + AGG+ ++ + G+L TV GD++ W+ ++ Sbjct: 307 PQLCKVAPNTQKYHIEDVHRAGGIMAILGELDRAGVLDTRVPTVYGDSLKEALDEWDIMR 366 Query: 360 ---------------GV---VNYNEDVILPR-------------EKALTKSGGIAVLRGN 388 GV V +++ P E A ++ GG+AVL GN Sbjct: 367 NPSPEVVEFFKAGPGGVPTQVAFSQSARWPTLDGDRANGCIRDLEHAFSREGGLAVLYGN 426 Query: 389 LAPRGAVLKPSAASPHLMQHKGRAVVFESIEDYHARINREDLDIDETCIMVLKYCGPKGY 448 +A G V+K + ++ +G A V ES + I + E ++V++Y GPKG Sbjct: 427 IAVDGCVVKTAGVDDSILVFEGPAHVVESQDQAVEHILAG--QVKEGEVVVIRYEGPKGG 484 Query: 449 PGMAEVGNMGLPPKVLK-KGITDMIR-ISDARMSGTAYGTVILHTAPEAAEGGPLALVEN 506 PGM E M P LK KG+ ++D R SG G I H +PEAA GG + LV + Sbjct: 485 PGMQE---MLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHVSPEAAAGGAIGLVRS 541 Query: 507 GDLIEVDIPNRTLHLHVSDEELARRRAA 534 GD+I +DIPNR + + +SD ELA RR A Sbjct: 542 GDIIRIDIPNRRIDVKLSDSELAARREA 569 Lambda K H 0.318 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 888 Number of extensions: 52 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 579 Length of database: 614 Length adjustment: 37 Effective length of query: 542 Effective length of database: 577 Effective search space: 312734 Effective search space used: 312734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory