Align Extracellular solute-binding protein, family 3 (characterized, see rationale)
to candidate WP_086508344.1 BZY95_RS02040 nickel transporter
Query= uniprot:E4PNW5 (250 letters) >NCBI__GCF_002151265.1:WP_086508344.1 Length = 261 Score = 268 bits (685), Expect = 8e-77 Identities = 136/256 (53%), Positives = 173/256 (67%), Gaps = 9/256 (3%) Query: 4 MIFAASCALALIAGGAQAQE-RDLRIAFDVPYEPFEYKDENGELTGFEVELAEAMCEEMN 62 MI AA+ A L AG AQA++ ++R+ D+PYEPF Y+ +GELTGFE+EL A+CE + Sbjct: 6 MILAATLAAGLTAGTAQARDYSEIRLGVDIPYEPFMYRQPDGELTGFEIELGNAVCEYLE 65 Query: 63 ANCEFVIQAWDGMIPGLLARKFDLIMSSMSITPERAERVLFSEPYYNTPGGWFGPESFNT 122 C +V Q WDG+IPGL+AR +D IMSSM+IT ERAERVLFSEPYY TP W + Sbjct: 66 VTCTWVEQDWDGIIPGLMARNYDAIMSSMAITEERAERVLFSEPYYTTPSAWITTRDRDI 125 Query: 123 DVTDMSAMEGKTVGVQRGTTMDTYVTENMGGIVTIKRYTTADDMVLDLEGQRLDVVFVDY 182 D+ D ++ G VGVQR T D YV+E G +V I+RYT+ADD+V D+ RLD+ F+DY Sbjct: 126 DIEDRDSLAGLVVGVQRATLQDNYVSELYGDLVEIRRYTSADDVVTDMRAGRLDLTFMDY 185 Query: 183 PVGEQTV---LTKEGFKEVGEAVK-----LGEGVGVAMRQRDTDLAEEVNAALRTLKEDG 234 PV E T+ + FK + +K G+GVGVA RQRD LAE N AL LKEDG Sbjct: 186 PVAENTMGIDTSGSHFKRISGFIKEPEHIFGKGVGVAFRQRDEALAERFNEALAALKEDG 245 Query: 235 TYDTIMQKYFAYDIKM 250 TYD IM++YF YDIK+ Sbjct: 246 TYDEIMERYFNYDIKL 261 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 261 Length adjustment: 24 Effective length of query: 226 Effective length of database: 237 Effective search space: 53562 Effective search space used: 53562 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory