Align Extracellular solute-binding protein, family 3 (characterized, see rationale)
to candidate WP_086508441.1 BZY95_RS02570 ABC transporter substrate-binding protein
Query= uniprot:E4PNW5 (250 letters) >NCBI__GCF_002151265.1:WP_086508441.1 Length = 264 Score = 114 bits (285), Expect = 2e-30 Identities = 75/240 (31%), Positives = 125/240 (52%), Gaps = 8/240 (3%) Query: 11 ALALIAGGAQAQERDLRIAFDVPYEPFEYKDENGELTGFEVELAEAMCEEMNANCEFVIQ 70 A L A+A++ A Y PF Y+ ENG+L GF+V++ A+ EEM E V Sbjct: 29 ATLLPVSEARAEQETFTYAMTGLYPPFSYR-ENGKLAGFDVDIGRALAEEMGMTAEPVAN 87 Query: 71 AWDGMIPGLLARKFDLIMSSMSITPERAERVLFSEPYYNTPGGWFGPESFNTDVTDMSAM 130 W +I L + +FD I+ SM+IT R E+V F++PYY++ G + N ++ ++ + Sbjct: 88 PWQTLIAALRSNRFDAIIGSMAITEARQEQVDFTDPYYSS-GAQVFISANNGELHEVEDI 146 Query: 131 EGKTVGVQRGTTMDTYVTENMGGIVTIKRYTTADDMVLDLEGQ-RLDVVFVDYPVGEQTV 189 GKT+GV ++ E + T YT + DL + R+D V D +GE + Sbjct: 147 RGKTLGVLVASSFADAAREYSDDLTT---YTDDVTALRDLTVRGRVDAVITDQLIGENAI 203 Query: 190 LTKE-GFKEVGEAVKLGEGVGVAMRQRDTDLAEEVNAALRTLKEDGTYDTIMQKYFAYDI 248 + +GE + + + +G+A+ + + +L E +N AL +K +G Y I ++YF DI Sbjct: 204 HNANLPVQPLGEPIYV-DDIGIAVNKGNEELLERLNEALAAIKANGRYAEISERYFGRDI 262 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 264 Length adjustment: 24 Effective length of query: 226 Effective length of database: 240 Effective search space: 54240 Effective search space used: 54240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory