Align Arginine N-succinyltransferase; AST; AOST; EC 2.3.1.109 (characterized)
to candidate WP_086508152.1 BZY95_RS01055 arginine N-succinyltransferase
Query= SwissProt::Q8ZPV1 (344 letters) >NCBI__GCF_002151265.1:WP_086508152.1 Length = 348 Score = 320 bits (819), Expect = 4e-92 Identities = 171/340 (50%), Positives = 221/340 (65%), Gaps = 8/340 (2%) Query: 4 IRPVEHADIAALMQLAGKTGGGLTSLPANEATLAARIERALKTWSGELPKGEQGYVFVLE 63 IRP+ D+ L ++A +TG G TSLP N LAA+I A+ + P + Y FVLE Sbjct: 3 IRPIAEGDLDELQKIARETGVGFTSLPDNREFLAAKIAAAVAAFEQRTPADRRNYFFVLE 62 Query: 64 DSETGEVGGICAIEVAVGLNDPWYNYRVGTLVHASKELNVYNALPTLFLSNDHTGSSELC 123 D E+GE+ G CAIE VG P+Y+YR+GTL H+S +L+++ + TLFLS+DHTG +E+ Sbjct: 63 DEESGELAGCCAIEGQVGREVPFYHYRLGTLAHSSVQLDLHRTIDTLFLSSDHTGDAEVA 122 Query: 124 TLFLDPEWR-----KEGNGYLLSKSRFMFMAAFRDKFNEKVVAEMRGVIDEHGYSPFWQS 178 +LFL P +R + NG LLS R++FMA FRD+F +KV+AEMRGV DE G SPFW+ Sbjct: 123 SLFLRPGFRGKERAHQRNGALLSMVRWLFMAEFRDQFPDKVLAEMRGVFDERGKSPFWEC 182 Query: 179 LGKRFFSMDFSRADFLCGTGQKAFIAELMPKHPIYTHFLSEEAQAVIGEVHPQTAPARAV 238 LG FF +DF AD L G GQK+FI ELMPK PIYT FLS+EA+A IG+VH T PA A+ Sbjct: 183 LGSHFFPLDFDEADRLTGLGQKSFIGELMPKFPIYTPFLSDEARACIGQVHHDTRPALAM 242 Query: 239 LEKEGFRYRHYIDIFDGGPTLECDIDRVRAIRKSRL--VEVAEGQPAPGDYPACLVANEN 296 L+KEG R+ YIDIFDGGPT+E ID VRA+RKS VE+ G P P L A+ Sbjct: 243 LKKEGLRWEGYIDIFDGGPTVEAYIDDVRAVRKSHCCRVEIRSGSDTPPARPRWLAASTT 302 Query: 297 YHHFRAALVRADP-QTSRLVLTAAQLDALKCRAGDHVRLV 335 FRAA V P + L L+ + L AGD +R++ Sbjct: 303 MAEFRAAWVACGPDEEGTLTLSETEAQRLGVAAGDSLRVL 342 Lambda K H 0.321 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 348 Length adjustment: 29 Effective length of query: 315 Effective length of database: 319 Effective search space: 100485 Effective search space used: 100485 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate WP_086508152.1 BZY95_RS01055 (arginine N-succinyltransferase)
to HMM TIGR03244 (astA: arginine N-succinyltransferase (EC 2.3.1.109))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03244.hmm # target sequence database: /tmp/gapView.8192.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03244 [M=336] Accession: TIGR03244 Description: arg_catab_AstA: arginine N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-128 412.9 0.0 4.8e-128 412.7 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086508152.1 BZY95_RS01055 arginine N-succiny Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086508152.1 BZY95_RS01055 arginine N-succinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 412.7 0.0 4.8e-128 4.8e-128 2 334 .. 3 342 .. 2 344 .. 0.96 Alignments for each domain: == domain 1 score: 412.7 bits; conditional E-value: 4.8e-128 TIGR03244 2 vrpvktsdldallelakeaGvGltslpaneellekrieraeksfageleraeegylfvledtetgkvvG 70 +rp+ + dld+l+++a+e+GvG+tslp n+e l+++i++a+ +f+++++++ ++y+fvled e+g+++G lcl|NCBI__GCF_002151265.1:WP_086508152.1 3 IRPIAEGDLDELQKIARETGVGFTSLPDNREFLAAKIAAAVAAFEQRTPADRRNYFFVLEDEESGELAG 71 8******************************************************************** PP TIGR03244 71 vsaieaavGleepfynyrvgkvvhaskelniykkletlflsndltgaselCtlfldeeyr.....keln 134 +aie +vG e pfy+yr+g++ h+s +l+++++++tlfls d+tg +e+ +lfl++ +r +++n lcl|NCBI__GCF_002151265.1:WP_086508152.1 72 CCAIEGQVGREVPFYHYRLGTLAHSSVQLDLHRTIDTLFLSSDHTGDAEVASLFLRPGFRgkeraHQRN 140 **********************************************************9954444578* PP TIGR03244 135 GkllskarflflaefkerfskkiiaemrGvsdeeGrsPfWealgkkffsldfskadylsgiGkkafiae 203 G lls +r lf+aef+++f +k++aemrGv+de G+sPfWe lg++ff ldf +ad l+g+G+k+fi e lcl|NCBI__GCF_002151265.1:WP_086508152.1 141 GALLSMVRWLFMAEFRDQFPDKVLAEMRGVFDERGKSPFWECLGSHFFPLDFDEADRLTGLGQKSFIGE 209 ********************************************************************* PP TIGR03244 204 lmPkfPiyvdllskeaqdvigkvhektkPalalleseGlryqgyvdifdaGptleaevakiravreskl 272 lmPkfPiy+ +ls+ea++ ig+vh++t+Pala+l++eGlr++gy+difd+Gpt+ea+++++ravr+s+ lcl|NCBI__GCF_002151265.1:WP_086508152.1 210 LMPKFPIYTPFLSDEARACIGQVHHDTRPALAMLKKEGLRWEGYIDIFDGGPTVEAYIDDVRAVRKSHC 278 ********************************************************************* PP TIGR03244 273 vevavaesaaed.eaepylvanekledfrvvlvess.ldaeelvlsaeeakalkveeGdkvrvv 334 + v++ + +++ ++ l a +++++fr+ v + ++l+ls++ea++l v +Gd++rv+ lcl|NCBI__GCF_002151265.1:WP_086508152.1 279 CRVEIRSGSDTPpARPRWLAASTTMAEFRAAWVACGpDEEGTLTLSETEAQRLGVAAGDSLRVL 342 ***99887776514567899999*******99998747889*********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (336 nodes) Target sequences: 1 (348 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.14 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory