Align succinylglutamate desuccinylase (EC 3.5.1.96) (characterized)
to candidate WP_086508349.1 BZY95_RS02065 succinylglutamate desuccinylase
Query= BRENDA::O50177 (332 letters) >NCBI__GCF_002151265.1:WP_086508349.1 Length = 328 Score = 208 bits (529), Expect = 2e-58 Identities = 137/329 (41%), Positives = 184/329 (55%), Gaps = 10/329 (3%) Query: 4 LGKLLDLTLAGREPTEKI-QLTADGTRLHWLAEGALEVTPIGARDNGVDLLLSAGIHGNE 62 L + ++L+L P +L RLH A G LE+TP R + S GIHGNE Sbjct: 2 LSEWIELSLEETRPIASSGRLRGGSYRLH--APGILELTPTECRATARACVFSVGIHGNE 59 Query: 63 TAPIELLERLIRKVAAGTLKPAARVLFLFGNPEAIRRGERYVEQDMNRLFNGRHEEGSGN 122 TAPIELL + ++ AG L A L + GN EAIRR ERYV ++NRLF R + +G Sbjct: 60 TAPIELLGNCLARIEAGLLPLGAPALIILGNLEAIRRAERYVNTNLNRLFR-RDLDETGM 118 Query: 123 EAFRAAELERLAQVFFSK-TERVHLHYDLHTAIRGSKIEQFALYPWAEGRQHSRSELAR- 180 E RA +L F+++ + R LHYDLHTAIR S+ +F + P+A R E R Sbjct: 119 EPDRARQLMSAVDDFYARHSGRERLHYDLHTAIRDSRFPRFVVEPFA--ATPIRPEQWRW 176 Query: 181 LRDAGIEAVLLQNKPGITFSAYTYGQLGAEAFTLELGKARPFGENQEVNLERLERSLELL 240 L +AGI+AVL Q++ TFS Y+ A+AFTLELG+A PFG N L + R LE L Sbjct: 177 LAEAGIQAVLHQHRHSWTFSHYSKHYHQAQAFTLELGRALPFGHNDLTALAPMTRLLEAL 236 Query: 241 IDGSEEQPDGSRLDGLKLFSVSREVIKHSDHFRLHLDDDVANFTELSPGYLLAEDIGGTR 300 ++G E P G+ + F V+ E+++ S FRL DD NFTE +PG LAED Sbjct: 237 LEGRE--PRGADPARMAFFRVAHELMRQSQDFRLCFPDDTPNFTEFAPGTRLAEDASAGP 294 Query: 301 WVVDEVGARIIFPNPRVKNGLRAGILVVP 329 + V + ++FPN V+ G RA +L P Sbjct: 295 FTVQDEPLSVVFPNAAVELGARAALLARP 323 Lambda K H 0.319 0.138 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 328 Length adjustment: 28 Effective length of query: 304 Effective length of database: 300 Effective search space: 91200 Effective search space used: 91200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory