Align glutaminase (EC 3.5.1.2) (characterized)
to candidate WP_086509069.1 BZY95_RS06040 glutaminase
Query= BRENDA::P0A6W0 (308 letters) >NCBI__GCF_002151265.1:WP_086509069.1 Length = 307 Score = 306 bits (785), Expect = 3e-88 Identities = 163/296 (55%), Positives = 205/296 (69%), Gaps = 1/296 (0%) Query: 8 AILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQERFSIQSI 67 A LE+I + R +G G+VA YIPALA D RLG A+CT DG L+ AGDA+ FSIQSI Sbjct: 3 AWLESIHARARSRLGSGRVASYIPALAEQDPERLGFAVCTNDGTLYAAGDAETPFSIQSI 62 Query: 68 SKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGALVVCDML 127 +KVL L +A+R + E +WQRVG +PSG PFNSL QLE E+G PRNPFINAGA+ V D L Sbjct: 63 AKVLLLTLALRVHGEA-LWQRVGLNPSGMPFNSLAQLEAERGKPRNPFINAGAIAVTDRL 121 Query: 128 QGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGNFHHDVTT 187 + P + + +V R L+G + I D V SE++H +RNAA+A+LMK+FGN +DV Sbjct: 122 VSAFATPDKHLQDVARRLAGNARILIDDEVLDSEWQHRSRNAAMAYLMKAFGNLDNDVDE 181 Query: 188 VLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMATSGMYQNA 247 VL+ YF CAL MSC +LA FLA G+A + E V+P R+INA+MAT GMY A Sbjct: 182 VLRTYFSCCALAMSCTDLAVAMNFLAADGEARAMGERFVSPGLTRRINAIMATCGMYDAA 241 Query: 248 GEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLTKQL 303 G+FA+RVGLPAKSGVGGGIVA+VP M + WSP LDD GNS+A LE ++L Sbjct: 242 GDFAYRVGLPAKSGVGGGIVAVVPGRMTVCAWSPALDDNGNSVAAQYALELFAEEL 297 Lambda K H 0.321 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 307 Length adjustment: 27 Effective length of query: 281 Effective length of database: 280 Effective search space: 78680 Effective search space used: 78680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory