Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate WP_086508345.1 BZY95_RS02045 nickel transporter
Query= reanno::pseudo3_N2E3:AO353_03055 (258 letters) >NCBI__GCF_002151265.1:WP_086508345.1 Length = 255 Score = 167 bits (424), Expect = 2e-46 Identities = 98/259 (37%), Positives = 150/259 (57%), Gaps = 15/259 (5%) Query: 1 MKKLVLLGALALSVLSLPTFA-DEKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCE 59 MKKL+ + L +++ + A D ++ G++ Y P + PDG + GFD D+GNALC Sbjct: 1 MKKLLTVSLLGVALAAGTAQARDYDHVRFGVDVPYEPMEYRTPDGELTGFDIDLGNALCA 60 Query: 60 EMKVKCVWVEQEFDGLIPALKVRKIDAILSSMSITDDRKKSVDFTNKYYNTPARLVMKAG 119 EM + C W+EQE+DG+IP L R DAI+SSM+I D+R++++ F++ Y P AG Sbjct: 61 EMGITCEWIEQEWDGIIPGLLARNYDAIMSSMTINDERRQTLLFSDPYITIPGAWFAPAG 120 Query: 120 TQVSD-NLAELKGKKIGVQRGSIHNRFAEEVLKPLGAEIKPYGSQNEIYLDVAAGRLD-- 176 + V + N L GK IGVQRG+ + + + + A + Y + +++ LD+ A RLD Sbjct: 121 SDVEEINEETLAGKSIGVQRGTTFDSYVTDNYGRV-ANVSRYSTADDMVLDLQAQRLDLV 179 Query: 177 ---GTVADATLLDDGFLKTDSGKGFAFVGPAFTD-EKYFGDGIGIAVRKGDKAELDKINA 232 V ATLLD+ SG+ F VG T+ E+YFG+G GIA R D+A + N Sbjct: 180 FLEFIVGQATLLDN-----HSGE-FEVVGEMVTEPEEYFGEGFGIAFRPRDEALAQRFNE 233 Query: 233 AIVAIRANGKYKQIQDKYF 251 A+ ++ +G Y +I +YF Sbjct: 234 ALATLKEDGTYDEIYQRYF 252 Lambda K H 0.318 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 255 Length adjustment: 24 Effective length of query: 234 Effective length of database: 231 Effective search space: 54054 Effective search space used: 54054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory