Align gamma-glutamylputrescine oxidase (EC 1.4.3.-) (characterized)
to candidate WP_086508430.1 BZY95_RS02515 FAD-binding oxidoreductase
Query= reanno::pseudo5_N2C3_1:AO356_21495 (427 letters) >NCBI__GCF_002151265.1:WP_086508430.1 Length = 428 Score = 345 bits (884), Expect = 2e-99 Identities = 178/424 (41%), Positives = 255/424 (60%), Gaps = 5/424 (1%) Query: 5 PYPESYYAASANPVPPRPALQDDVETDVCVIGAGYTGLSSALFLLENGFKVTVLEAAKVG 64 P SYY AS + P L+ +V DV ++G G+TG+++A+ L E G++V ++EA K+G Sbjct: 4 PRCASYYTASIHQESDYPRLEGEVTVDVAIVGGGFTGVATAVELAERGYRVAIVEANKIG 63 Query: 65 FGASGRNGGQIVNSYSRDIDV---IERSVGPQQAQLLGNMAFEGGRIIRERVAKYQIQCD 121 +GASGRNGGQ+ S S + + + R++G + N+ + G RIIR+RV +Y I CD Sbjct: 64 WGASGRNGGQVTGSLSGEAAMRKQMRRTLGEAADDFVWNLRWRGQRIIRQRVEQYGIACD 123 Query: 122 LKDGGVFAALTAKQMGHLESQKRLWERFGHTQ-LELLDQRRIREVVACEEYVGGMLDMSG 180 LK G + AA M L + + G + +ELLD ++R+V+ E Y GG+L+ Sbjct: 124 LKHGHLQAAWKPSHMTALRADFEACQARGMGEHVELLDAHQVRDVIRTELYHGGLLNRYN 183 Query: 181 GHIHPLNLALGEAAAVESLGGVIYEQSPAVRIERGASPVVHTPQGKVRAKFIIVAGNAYL 240 H+HPLNL LGEA LG +I+E SP RI+ G SP V T G +RA +++AGNAY Sbjct: 184 LHLHPLNLCLGEARVAAGLGALIFEHSPVERIDHGPSPAVITAHGTLRADRVLLAGNAYH 243 Query: 241 GNLVPELAAKSMPCGTQVIATEPLGDELAHSLLPQDYCVEDCNYLLDYYRLTGDKRLIFG 300 L ++ P ++ T PLG LA ++ PQD V DC ++LDYYRLT D RL+FG Sbjct: 244 RLERRRLGSRLFPASLGIVTTAPLGG-LAEAINPQDLAVYDCRFVLDYYRLTADGRLLFG 302 Query: 301 GGVVYGARDPANIEAIIRPKMLKAFPQLKDVKIDYAWTGNFLLTLSRLPQVGRLGDNIYY 360 GG Y +D +I A +RP++ FPQL IDYAW G + ++R+P +G+L D +YY Sbjct: 303 GGANYSGKDSPDIAAELRPRLEATFPQLAGTPIDYAWQGMAGIVINRIPMLGKLSDTVYY 362 Query: 361 SQGCSGHGVTYTHLAGKVLAEALRGQAERFDAFADLPHYPFPGGQLLRTPFAAMGAWYYG 420 +QG SGHGV +H+ G+++A+A+ G E FD FA H P G L P A G WYY Sbjct: 363 AQGYSGHGVATSHIVGEIMAKAIAGHMEEFDTFAACRHLKVPFGDALGNPLLAAGMWYYQ 422 Query: 421 LRDK 424 L ++ Sbjct: 423 LLER 426 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 611 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 428 Length adjustment: 32 Effective length of query: 395 Effective length of database: 396 Effective search space: 156420 Effective search space used: 156420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory