Align Phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate WP_086510572.1 BZY95_RS14225 phosphopentomutase
Query= reanno::MR1:200397 (404 letters) >NCBI__GCF_002151265.1:WP_086510572.1 Length = 412 Score = 541 bits (1394), Expect = e-158 Identities = 265/405 (65%), Positives = 314/405 (77%), Gaps = 1/405 (0%) Query: 1 MKRTVIMMLDSFGVGAAGDAAKFGDVGSDTFGHIAKACAEGKAD-TGRKGPLALPNLARL 59 M R ++++LDSFG+GAA DA +FGD G+DT GHIA AC+ G+ D R+G LALPNL RL Sbjct: 1 MTRAIVLVLDSFGIGAAPDAERFGDAGADTLGHIAAACSRGECDGADRQGSLALPNLGRL 60 Query: 60 GLAHAAMESTGAFAPGFADNVDLIGAYGHAQELSSGKDTPSGHWEMAGVPVLFEWGYFSE 119 GL HA ESTGA+A G ++IGAYGHA E+SSGKDTPSGHWE+AGVPV F+WGYF + Sbjct: 61 GLFHAHRESTGAWAEGVELPAEVIGAYGHAGEISSGKDTPSGHWEIAGVPVRFDWGYFLD 120 Query: 120 HQNSFPKELTDKILARAGLDGFLGNCHASGTTILEELGEEHMRSGKPIFYTSADSVFQIA 179 + SFP EL ++ L G LGNCHASGT I+ LGE+HM SGKPI YTSADSV QIA Sbjct: 121 REESFPPELLAALIREGELPGVLGNCHASGTEIIARLGEQHMASGKPIVYTSADSVLQIA 180 Query: 180 CHEGTFGLENLYRLCEIAREELEPYNIGRVIARPFDGTGPSDFARTGNRKDYSLEPPAKT 239 HE +FGL L+ LCE AR LEPYNIGRVIARPF G DF+RT NR+DYS+EPPA T Sbjct: 181 AHEESFGLARLHALCETARRLLEPYNIGRVIARPFVGQHADDFSRTANRRDYSVEPPAPT 240 Query: 240 VLDKLKAAGGEVVSVGKIADIYAYCGITKKVKANGLEALFDATLAEVKSAGENTIVFTNF 299 VL KL GGEV+++GKIADIYA+CG+T+ +KA+G +AL DATLA + AGE ++V TNF Sbjct: 241 VLQKLCDDGGEVIAIGKIADIYAHCGVTRTLKASGHDALMDATLAALDEAGERSLVMTNF 300 Query: 300 VDFDSHYGHRRDVAGYAKGLEYFDARLPEMLALLDEDDLLILTADHGCDPTWQGTDHTRE 359 VDFD+ YGHRRDV GYA LE FDARLPE+LA L + DLL++TADHGCDPTW GTDHTRE Sbjct: 301 VDFDTLYGHRRDVTGYAAALEAFDARLPELLARLRDGDLLVITADHGCDPTWHGTDHTRE 360 Query: 360 YVPVLAYGAGLKAGSLGRRNSFADIGQSIASYFKLEPMEYGESFI 404 VPVLA GAGL GSLG R++FADIGQS+A++ L PM G SFI Sbjct: 361 RVPVLALGAGLAPGSLGARDTFADIGQSLAAHLGLPPMADGTSFI 405 Lambda K H 0.318 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 619 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 412 Length adjustment: 31 Effective length of query: 373 Effective length of database: 381 Effective search space: 142113 Effective search space used: 142113 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_086510572.1 BZY95_RS14225 (phosphopentomutase)
to HMM TIGR01696 (deoB: phosphopentomutase (EC 5.4.2.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01696.hmm # target sequence database: /tmp/gapView.2353.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01696 [M=381] Accession: TIGR01696 Description: deoB: phosphopentomutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-159 515.8 0.0 3.4e-159 515.7 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086510572.1 BZY95_RS14225 phosphopentomutase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086510572.1 BZY95_RS14225 phosphopentomutase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 515.7 0.0 3.4e-159 3.4e-159 1 373 [. 3 395 .. 3 403 .. 0.97 Alignments for each domain: == domain 1 score: 515.7 bits; conditional E-value: 3.4e-159 TIGR01696 1 rvflivldsvGiGeaedaadfkdeGadtlghiaealdk...........lnlpnleklGlgkiee.... 54 r+ ++vlds+GiG+a+da++f+d Gadtlghia a+++ l lpnl +lGl +++ lcl|NCBI__GCF_002151265.1:WP_086510572.1 3 RAIVLVLDSFGIGAAPDAERFGDAGADTLGHIAAACSRgecdgadrqgsLALPNLGRLGLFHAHRestg 71 7899*********************************99************************999999 PP TIGR01696 55 ..lagvdaveevlayyaklseassGkdtmtGhweiaGlnilkefkvfs...ngfpeelldkleeragrk 118 +gv+ +ev+++y+++ e+ssGkdt++GhweiaG+++ +++++f ++fp ell l + +++ lcl|NCBI__GCF_002151265.1:WP_086510572.1 72 awAEGVELPAEVIGAYGHAGEISSGKDTPSGHWEIAGVPVRFDWGYFLdreESFPPELLAALIREGELP 140 9999*******************************************88889***************** PP TIGR01696 119 .vlgnkpasGtvildelGeehmktGklivytsadsvlqiaaheevvpleelyelcekarellkdpkyli 186 vlgn++asGt i+ +lGe+hm +Gk+ivytsadsvlqiaahee ++l +l+ lce+ar ll y+i lcl|NCBI__GCF_002151265.1:WP_086510572.1 141 gVLGNCHASGTEIIARLGEQHMASGKPIVYTSADSVLQIAAHEESFGLARLHALCETARRLLE--PYNI 207 9**********************************************************9985..5*** PP TIGR01696 187 GriiarpfvGe.aGnfkrtsnrhdyalkpfaktvldklkdekydvisiGkiadiydgeGitkkvrtksn 254 Gr+iarpfvG+ a +f rt+nr dy+++p+a+tvl+kl d + +vi+iGkiadiy+ +G+t++ ++ + lcl|NCBI__GCF_002151265.1:WP_086510572.1 208 GRVIARPFVGQhADDFSRTANRRDYSVEPPAPTVLQKLCDDGGEVIAIGKIADIYAHCGVTRTLKASGH 276 **********9999******************************************************* PP TIGR01696 255 mdgldkvikelkedftg.isfanlvdfdalyGhrrdkeGyaaaleefdarlpellsklreddlliltad 322 ++++d+++ l+e+++ ++++n+vdfd+lyGhrrd++Gyaaale fdarlpell++lr+ dll++tad lcl|NCBI__GCF_002151265.1:WP_086510572.1 277 DALMDATLAALDEAGERsLVMTNFVDFDTLYGHRRDVTGYAAALEAFDARLPELLARLRDGDLLVITAD 345 ***************988*************************************************** PP TIGR01696 323 hGndptatGtdhtreyipvlvyspkvkkgqalesaetfadiGatladnfnt 373 hG+dpt++Gtdhtre +pvl+ + +g +l+ ++tfadiG++la +++ lcl|NCBI__GCF_002151265.1:WP_086510572.1 346 HGCDPTWHGTDHTRERVPVLALGAGLAPG-SLGARDTFADIGQSLAAHLGL 395 *****************************.****************98876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (381 nodes) Target sequences: 1 (412 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.86 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory