Align purine-nucleoside phosphorylase (EC 2.4.2.1) (characterized)
to candidate WP_086510571.1 BZY95_RS14220 purine-nucleoside phosphorylase
Query= BRENDA::P0ABP8 (239 letters) >NCBI__GCF_002151265.1:WP_086510571.1 Length = 242 Score = 336 bits (862), Expect = 2e-97 Identities = 164/237 (69%), Positives = 196/237 (82%) Query: 1 MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISV 60 MATPHI E G FAD VLMPGDPLRAK+IAETFLEDAREV +VR MLGFTG Y+GR ISV Sbjct: 1 MATPHIQGERGIFADTVLMPGDPLRAKHIAETFLEDAREVTSVRNMLGFTGRYRGRDISV 60 Query: 61 MGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIR 120 MGHGMGIPS SIY KELITD+GV+++IRVGSCGAV V +RDVVIG+GA TDS VNR R Sbjct: 61 MGHGMGIPSVSIYAKELITDYGVQRLIRVGSCGAVRDDVAVRDVVIGLGASTDSAVNRTR 120 Query: 121 FKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVE 180 F HDFAAIADF++ R+AVDAA A G+ +VGNLFS DLFY+P E+F +M++YGI+GVE Sbjct: 121 FMGHDFAAIADFELTRHAVDAAAAQGVPVKVGNLFSTDLFYNPQAELFTLMKRYGIVGVE 180 Query: 181 MEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLGD 237 MEAAG+YGVAAEFG +A+TICTVSDHI E + R+ +FN+M+++AL++VL D Sbjct: 181 MEAAGLYGVAAEFGGRAMTICTVSDHILKGESLPSEARERSFNEMVEVALDAVLRDD 237 Lambda K H 0.322 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 239 Length of database: 242 Length adjustment: 23 Effective length of query: 216 Effective length of database: 219 Effective search space: 47304 Effective search space used: 47304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
Align candidate WP_086510571.1 BZY95_RS14220 (purine-nucleoside phosphorylase)
to HMM TIGR00107 (deoD: purine nucleoside phosphorylase (EC 2.4.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00107.hmm # target sequence database: /tmp/gapView.12765.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00107 [M=232] Accession: TIGR00107 Description: deoD: purine nucleoside phosphorylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-110 354.8 0.0 1.1e-110 354.6 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086510571.1 BZY95_RS14220 purine-nucleoside Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086510571.1 BZY95_RS14220 purine-nucleoside phosphorylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 354.6 0.0 1.1e-110 1.1e-110 1 230 [. 5 234 .. 5 236 .. 0.99 Alignments for each domain: == domain 1 score: 354.6 bits; conditional E-value: 1.1e-110 TIGR00107 1 hinakkgdiadvvllpGdPlrakyiaekfledakevnevrgmlgftGkykgkkisvmGhGmGipsisiy 69 hi+ ++g +ad+vl+pGdPlrak+iae+fleda+ev+ vr+mlgftG+y+g+ isvmGhGmGips+siy lcl|NCBI__GCF_002151265.1:WP_086510571.1 5 HIQGERGIFADTVLMPGDPLRAKHIAETFLEDAREVTSVRNMLGFTGRYRGRDISVMGHGMGIPSVSIY 73 9******************************************************************** PP TIGR00107 70 skelikeyevkkiirvGsCGairkkvklkdviialkastdskvnrvrfvevdlaaiadfelvklakeaa 138 +keli++y+v+++irvGsCGa+r +v ++dv+i+l+astds vnr rf+ +d+aaiadfel+++a++aa lcl|NCBI__GCF_002151265.1:WP_086510571.1 74 AKELITDYGVQRLIRVGSCGAVRDDVAVRDVVIGLGASTDSAVNRTRFMGHDFAAIADFELTRHAVDAA 142 ********************************************************************* PP TIGR00107 139 kkkgldvkvGnvfsadlfystdkevldllekygvlavemeaaalyavaaelgkkaltlltvsdhlvthe 207 ++g++vkvGn+fs+dlfy+++ e + l+++yg+++vemeaa+ly+vaae+g +a+t++tvsdh++ e lcl|NCBI__GCF_002151265.1:WP_086510571.1 143 AAQGVPVKVGNLFSTDLFYNPQAELFTLMKRYGIVGVEMEAAGLYGVAAEFGGRAMTICTVSDHILKGE 211 ********************************************************************* PP TIGR00107 208 altaeerqktfkdmielalesvs 230 l++e r ++f++m+e+al++v+ lcl|NCBI__GCF_002151265.1:WP_086510571.1 212 SLPSEARERSFNEMVEVALDAVL 234 ********************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (232 nodes) Target sequences: 1 (242 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 7.82 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory