Align L-2-keto-3-deoxyrhamnonate 4-dehydrogenase subunit (EC 1.1.1.401) (characterized)
to candidate WP_086508662.1 BZY95_RS03830 isomerase/hydrolase
Query= metacyc::MONOMER-16233 (285 letters) >NCBI__GCF_002151265.1:WP_086508662.1 Length = 221 Score = 116 bits (290), Expect = 5e-31 Identities = 69/183 (37%), Positives = 100/183 (54%), Gaps = 4/183 (2%) Query: 65 IGKIVAIGLNYEDHAIESNLPIPTEPMMFMKALSSLNGPNDEVVLPKNSTHGDWEVELGV 124 +GKIV IG NY DHA E + PIPTEP++F+K +S ++ + P + +E EL + Sbjct: 17 LGKIVCIGRNYADHAKELDNPIPTEPLLFIKPATSAVSLDEPLDPPFSRGEVHYEAELAL 76 Query: 125 VIGETCRFVSEDEALSKVAGYVLVNDVSERFNQ---KQRGTQWSKGKGHDTFCPVGPWLV 181 +IGET + DEA + G L D++ R Q K++G W K D CP+ +L Sbjct: 77 LIGETLSHATADEAERAIVGIGLALDLTLRDVQTRLKEKGHPWEIAKAFDGACPLSAFLP 136 Query: 182 TPDEVGDPQDLDMHLNVNGTRMQTGNTKTMIFNVAQLISYVSEYITLYPGDLMITGTPPG 241 + L L ++G Q G M+F V L++ +S + TL PGD++ITGTP G Sbjct: 137 L-SRAPNWNALTFELEIDGELRQHGEGSDMLFPVPTLVAEMSRHFTLEPGDVVITGTPEG 195 Query: 242 VGE 244 VGE Sbjct: 196 VGE 198 Lambda K H 0.316 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 221 Length adjustment: 24 Effective length of query: 261 Effective length of database: 197 Effective search space: 51417 Effective search space used: 51417 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory