Align Short-chain dehydrogenase (characterized, see rationale)
to candidate WP_086510166.1 BZY95_RS12005 SDR family NAD(P)-dependent oxidoreductase
Query= uniprot:A0A2E7P8M8 (258 letters) >NCBI__GCF_002151265.1:WP_086510166.1 Length = 257 Score = 79.7 bits (195), Expect = 5e-20 Identities = 75/244 (30%), Positives = 112/244 (45%), Gaps = 23/244 (9%) Query: 10 VIVTGGASGIGGAISLQLAAEGAIPVVFARSEPDPQFWARLTGLQPRAALFQLELQDEAR 69 V+VT GA+GIG AI+ GA V E A L L A + ++ EA Sbjct: 15 VLVTAGANGIGLAIAQAFHEAGARVHVCDVDE------AALAALPEGIAATRADVSREAE 68 Query: 70 CGEAVAETVRRFGRLDGLVNNAGV-NDSVGLDAGRNE-FVASLERNLIHYYVMAHYCVPH 127 E G LD +VNNAG+ + G+D +E + +++ NL Y +A Sbjct: 69 VARLFDEAAG-LGGLDVVVNNAGIAGPTAGIDEIESEAWRQTIDINLNGQYYVAKRAAGA 127 Query: 128 LKATRGAILNVSSKTALTGQGNTSGYCASKGAQLSLTREWAAALRDDGVRVNALIPAEVM 187 L+ +RG +LN++S G + Y ASK + LT+ A L GVRVNA++P V Sbjct: 128 LRESRGVLLNMASVAGRLGFAYRTPYAASKWGVVGLTKSLACELGPAGVRVNAILPGIVR 187 Query: 188 TPLYEKWIA---------TFENPQEKLDAITSKIPLGKRFTTSEEMADMAVFLLSGRSSH 238 P E+ IA E QE L ++ ++ ++A MA+FL S ++ Sbjct: 188 GPRIERVIADRAAQRGIGRDEMEQENLAKVSM-----RKMVEPSDIAAMALFLASPGGAN 242 Query: 239 TTGQ 242 +GQ Sbjct: 243 ISGQ 246 Lambda K H 0.318 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 257 Length adjustment: 24 Effective length of query: 234 Effective length of database: 233 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory