Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate WP_086508966.1 BZY95_RS05475 3-oxoacyl-ACP reductase
Query= SwissProt::Q8P3K4 (300 letters) >NCBI__GCF_002151265.1:WP_086508966.1 Length = 248 Score = 121 bits (303), Expect = 2e-32 Identities = 81/243 (33%), Positives = 122/243 (50%), Gaps = 17/243 (6%) Query: 64 ITAAGAGIGRESALACARAGAHVIA----TDIDAAALQALAAES-DAITTQLLDVTD--- 115 +T GIG A A AG HV+A + L++ A+ D I+ +D+TD Sbjct: 10 VTGGTGGIGSAICRALAAAGYHVVAGYHNPEKAKTWLESQKADGFDNISLSGVDLTDYQA 69 Query: 116 -AAAITALVAAHGPFDVLFNCAGYVHQGSILDCDEPAWRRSFSINVDAMYYTCKAVLPGM 174 A + + AHGP VL NCAG G++ W N++ ++ TC++V+ GM Sbjct: 70 CEAGVKEIEEAHGPISVLVNCAGITRDGTMKKMTPEQWHEVIDTNLNTVFNTCRSVIEGM 129 Query: 175 LERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSKAIAADYVAQGVRCNAICPGTI 234 LE G IIN+SS+ + KG + Y KA + GL+ A+A + +G+ N + PG I Sbjct: 130 LEHKYGRIINISSI-NGRKGQFGQVNYSAAKAGMHGLTMALAQETATKGITVNTVSPGYI 188 Query: 235 KTPSLGQRVQALGGDEQAVWKSFTDRQPMGRLGDPREIAQLVVYLASDESSFTTGQTHII 294 T + + + V ++ + P+ R G P EIA+LVV+LA ES F TG I Sbjct: 189 ATDMIMK-------IPENVREAIRETIPVKRYGTPEEIARLVVFLADKESGFITGANIDI 241 Query: 295 DGG 297 +GG Sbjct: 242 NGG 244 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 248 Length adjustment: 25 Effective length of query: 275 Effective length of database: 223 Effective search space: 61325 Effective search space used: 61325 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory