Align Short-chain dehydrogenase/reductase SDR (characterized, see rationale)
to candidate WP_086509100.1 BZY95_RS06195 KR domain-containing protein
Query= uniprot:B2T9V3 (247 letters) >NCBI__GCF_002151265.1:WP_086509100.1 Length = 249 Score = 291 bits (745), Expect = 8e-84 Identities = 155/246 (63%), Positives = 184/246 (74%), Gaps = 4/246 (1%) Query: 4 RLAGKTALITAAGQGIGLATAELFAREGARVIATDIRIDGLAG----KPVEARKLDVRDD 59 RL KTALITAAGQGIG ATA FA EGARVIATDI D L +EAR+LDV D Sbjct: 2 RLQHKTALITAAGQGIGRATALRFAAEGARVIATDIDADKLRDLGDTPGIEARRLDVLDA 61 Query: 60 AAIKALAAEIGAVDVLFNCAGFVHAGNILECSEEDWDFAFDLNVKAMYRMIRAFLPAMLD 119 A+ ALA E+ +++VLFNCAG+V +G +LE S+ DW+ + LNV AM R+ R LP M+ Sbjct: 62 EAVTALAKELASLNVLFNCAGYVASGALLEVSDADWERSLALNVTAMLRLTRTLLPTMIA 121 Query: 120 KGGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGVRCNAICPGTVAS 179 GGGSIINM+S ASS+ GVPNR AY +KAAV+GLTKS+AAD+I RG+RCNAICPGTV S Sbjct: 122 GGGGSIINMASVASSLTGVPNRCAYGTTKAAVLGLTKSIAADYIDRGIRCNAICPGTVDS 181 Query: 180 PSLEQRIVAQAQAQGATLDAVQAAFVARQPMGRIGKPEEIAALALYLGSDESSFTTGHAH 239 PSL QRI QA+ QG V A F+ARQP+GR+G EEIAALA YL +DES++TTG A Sbjct: 182 PSLRQRIREQAERQGRPEAEVHAEFLARQPLGRLGTAEEIAALATYLAADESAYTTGTAQ 241 Query: 240 VIDGGW 245 VIDGGW Sbjct: 242 VIDGGW 247 Lambda K H 0.320 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 249 Length adjustment: 24 Effective length of query: 223 Effective length of database: 225 Effective search space: 50175 Effective search space used: 50175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory