Align Probable 5-dehydro-4-deoxyglucarate dehydratase; EC 4.2.1.41; 5-keto-4-deoxy-glucarate dehydratase; KDGDH (uncharacterized)
to candidate WP_010629732.1 BZY95_RS18815 4-hydroxy-tetrahydrodipicolinate synthase
Query= curated2:A4YNH1 (314 letters) >NCBI__GCF_002151265.1:WP_010629732.1 Length = 294 Score = 93.2 bits (230), Expect = 7e-24 Identities = 89/278 (32%), Positives = 135/278 (48%), Gaps = 24/278 (8%) Query: 23 TPFKADYSFDETTYRSNMDWLCGYDVAGLFAAGGTGEFFSLTAAEVPEVVKVAVDETKGR 82 TP KA+ D R +++ G+ AAG TGE +++ AE +V++ V+E GR Sbjct: 11 TPMKANGDIDWEALRRLVNFHLENGTDGIVAAGTTGEPTTMSFAEHFDVIRAVVEEVDGR 70 Query: 83 VPVLAGTG-YGTAIAREIAMSAEKAGADGLLLLPPYLMHAEQEGLAAHVEAVCKSVKIGV 141 +PV+AGTG T+ A E+A A + GAD L + PY QEGL H +AV + ++ V Sbjct: 71 IPVIAGTGANATSEAVELARYASEVGADYCLSVCPYYNKPTQEGLYRHFKAVAEGSRLPV 130 Query: 142 IVYN---RDNAILQPDTLARLCERCPNLVGYKDGIGDIE----LMTRVYTKMGDRLTYIG 194 I+YN R + L +T+ RL E N++G KD G++E L++R+ K + Y G Sbjct: 131 ILYNVPGRTCSDLYNETVMRLAE-VDNIIGLKDATGNLERAEDLISRL--KGSGFMLYSG 187 Query: 195 GLPTAETFALPYLDMGVTTYSSAVFNFVPEFATNFYAAVRKRDHATIHAGLKDFILPL-- 252 TA F L MG S N P+ A D H + ++PL Sbjct: 188 DDSTACEFML----MGGNGDISVTANVAPKAMHELCVAAVAGDADRAHQ-INTRLMPLHT 242 Query: 253 -IAIRNRKKGYAVSIIKAGMKVIGRDSGPVRLPLTDLT 289 + I + ++ + G+ D G +RLPLT L+ Sbjct: 243 NLGIESNPIPVKWALHRMGL----IDQG-IRLPLTWLS 275 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 294 Length adjustment: 27 Effective length of query: 287 Effective length of database: 267 Effective search space: 76629 Effective search space used: 76629 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory