Align Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_086511010.1 BZY95_RS16615 carbohydrate ABC transporter permease
Query= uniprot:A0A165KQ00 (289 letters) >NCBI__GCF_002151265.1:WP_086511010.1 Length = 275 Score = 123 bits (309), Expect = 4e-33 Identities = 86/271 (31%), Positives = 133/271 (49%), Gaps = 9/271 (3%) Query: 19 VLALATAFFLLPLYAMLVTSFKYAEEIRSTSLLALPGSLNWSAWGTAWQSACTGVDCNGL 78 VL L + + PL A FK E+R T+ L LP + N + + +D N Sbjct: 14 VLILVASLVIGPLLASFFGGFKTNAELR-TNPLWLPDAWNPQNYVAIF------LDGNFW 66 Query: 79 RPFFMNSVAMAVPAVLISTVWGALNGYVLSLWKFRGSDALFGMLLFGVFMPFQVVLLPMS 138 R + NS ++ VL++ V GA YV S +F GS + LL G+ PF +LP+ Sbjct: 67 R-YMGNSFFISSMTVLLTLVVGAAAAYVFSQIRFFGSRMIHSYLLLGLMFPFAAAILPLF 125 Query: 139 QVLGWLGLSSSITGLVLVHCLAGLAGTTLFFRNYYAAIPKELVNAARMDGASFFQIFWRI 198 + LGL + ++L GL+ L F+ ++ +PKEL AA +DG S+ + FW Sbjct: 126 IKVRDLGLLDTYWAVILPQTAFGLSLAILLFKAFFDQLPKELFEAAYVDGCSYLRFFWSF 185 Query: 199 VLPLSTPIVMVTLIWQFTNIWNDFLFGVVFSGTDSKPVTVGLNNLANTSSSVKAYNVDMA 258 LPLSTPI+ ++ F WN+FL +V D T L + + +N+ +A Sbjct: 186 TLPLSTPILATVGVFVFVQSWNNFLLPLVVL-NDRSIYTWPLGMMQFQGEYLTQWNMILA 244 Query: 259 AAIIAGLPTMVIYVLAGKFFVRGLTAGAVKG 289 + P ++ ++ A K+ V GLT G+VKG Sbjct: 245 FVTLTITPAVIFFLAAQKYIVAGLTGGSVKG 275 Lambda K H 0.327 0.139 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 275 Length adjustment: 26 Effective length of query: 263 Effective length of database: 249 Effective search space: 65487 Effective search space used: 65487 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory