Align D-galactarolactone cycloisomerase (EC 5.5.1.27) (characterized)
to candidate WP_086510674.1 BZY95_RS14780 amidohydrolase
Query= BRENDA::A9CEQ7 (292 letters) >NCBI__GCF_002151265.1:WP_086510674.1 Length = 297 Score = 239 bits (611), Expect = 4e-68 Identities = 128/286 (44%), Positives = 170/286 (59%), Gaps = 6/286 (2%) Query: 6 RKLSGTAPNPAFPRGAVDTQMHMYLPGYPALPGGPGLPPGALPGPEDYRRLMQWLGIDRV 65 R L G P P GA D MH+YLPG+ A PGGPG+ L EDYRR+ LG++RV Sbjct: 9 RPLDGPPPRLVAPPGATDCHMHLYLPGFAAQPGGPGIVE--LATVEDYRRVQARLGLERV 66 Query: 66 IITQGNAHQRDNGNTLACVAEMG-EAAHAVVIIDATTTEKDMEKLTAAGTVGARIMDLPG 124 ++TQ NA+Q DNG L + ++G EAA V + T E + A G GARIM+LPG Sbjct: 67 VVTQSNAYQLDNGALLEALDQLGNEAARGVAAVAPGTAEATLRDWHAKGVRGARIMNLPG 126 Query: 125 GAVNLSELDAVDERAHAADWMVAVQFDGNGLLDHLPRLQKIRSRWVFDHHGKFFKGIRTD 184 GAV +++ AV+ W + VQF+G L D+L LQ++ ++ DH GKF + D Sbjct: 127 GAVTHADMPAVERLVRPLGWHLMVQFNGQHLDDYLDGLQRLEGDYIIDHIGKFMPPVPAD 186 Query: 185 GPEMAALLKLIDRGNLWFKFAGVYESSRKSWP-YADVAAFSRVIAAHAPERIVWGTNWPH 243 + A+L+L+DRGN WFK G YE+S P Y DV A + + AHAPER++WG+NWPH Sbjct: 187 DRRVDAILRLLDRGNAWFKLCGGYETSLTGGPRYEDVGAIAWRVVAHAPERVIWGSNWPH 246 Query: 244 NSVRETAAYPDDARLAELTLGWLPDEAARHRALVENPEALFKLSPV 289 V YPDDA ++ LGW E AR R LV+NP AL+ P+ Sbjct: 247 VGV-PRERYPDDAEQLDVLLGWAGPE-ARRRILVDNPAALYGFPPL 290 Lambda K H 0.319 0.136 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 297 Length adjustment: 26 Effective length of query: 266 Effective length of database: 271 Effective search space: 72086 Effective search space used: 72086 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory