Align uronate dehydrogenase (EC 1.1.1.203) (characterized)
to candidate WP_086510673.1 BZY95_RS14775 NAD(P)-dependent oxidoreductase
Query= BRENDA::Q7CRQ0 (265 letters) >NCBI__GCF_002151265.1:WP_086510673.1 Length = 265 Score = 298 bits (763), Expect = 8e-86 Identities = 140/259 (54%), Positives = 180/259 (69%) Query: 1 MKRLLVTGAAGQLGRVMRERLAPMAEILRLADLSPLDPAGPNEECVQCDLADANAVNAMV 60 ++RLLVTGA G +GR++R LA +A +RL+D++ L A +EE V CDLADA AV +V Sbjct: 2 IERLLVTGAGGGMGRLIRPHLAQLARTVRLSDIADLGEAASHEELVPCDLADAEAVGELV 61 Query: 61 AGCDGIVHLGGISVEKPFEQILQGNIIGLYNLYEAARAHGQPRIVFASSNHTIGYYPQTE 120 GCD I+HLGG+SVEKP+ +LQ NI+G YNLYEAAR HG+PR++FASSNHT GYY +T+ Sbjct: 62 QGCDAIIHLGGVSVEKPWASLLQANIVGTYNLYEAARRHGKPRVIFASSNHTTGYYERTQ 121 Query: 121 RLGPDVPARPDGLYGVSKCFGENLARMYFDKFGQETALVRIGSCTPEPNNYRMLSTWFSH 180 R+ VP RPD LYGV+KCFGE+LA +Y DKFG ET VRIG C +P + R L+ W S Sbjct: 122 RIDTTVPRRPDSLYGVTKCFGEDLASLYHDKFGVETLSVRIGWCHSQPTDTRKLAIWLSA 181 Query: 181 DDFVSLIEAVFRAPVLGCPVVWGASANDAGWWDNSHLGFLGWKPKDNAEAFRRHITETTP 240 DF+SL++ P LGC VV+G S N WWDNS FLGW PKD++ +R + Sbjct: 182 GDFISLVQRAIVTPRLGCTVVYGFSNNAERWWDNSQAAFLGWVPKDSSAPWREELEALDT 241 Query: 241 PPDPNDALVRFQGGTFVDN 259 DP D V +QGG+F + Sbjct: 242 NLDPTDPAVIYQGGSFASS 260 Lambda K H 0.321 0.139 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 265 Length adjustment: 25 Effective length of query: 240 Effective length of database: 240 Effective search space: 57600 Effective search space used: 57600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory