Align GlpQ, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_086511670.1 BZY95_RS20110 carbohydrate ABC transporter permease
Query= TCDB::G3LHZ1 (273 letters) >NCBI__GCF_002151265.1:WP_086511670.1 Length = 297 Score = 412 bits (1059), Expect = e-120 Identities = 189/255 (74%), Positives = 226/255 (88%) Query: 18 IYIIFLILPIYWLINMSFKENSEITGAFSLWPTNPTLRNYTVIFTDPSWYNGYINSIIYV 77 +Y++F++LPIYWL+N+SF+ NSEI G+FS WP N T+ NY IFTD +WY GY+NS+ YV Sbjct: 42 LYLVFVMLPIYWLLNLSFQTNSEILGSFSFWPQNFTVANYARIFTDANWYMGYVNSLAYV 101 Query: 78 VMNTVISVAAALPAAYAFSRYRFLGDKHLFFWLLTNRMAPPAVFALPFFQLYSAFGLIDT 137 +MN +IS++ ALPAAYAFSR+RF+GDKHLFFWLLTN MAPPAVF LP+FQLY + GL DT Sbjct: 102 LMNMLISISVALPAAYAFSRFRFIGDKHLFFWLLTNLMAPPAVFLLPYFQLYYSVGLFDT 161 Query: 138 HIAVALAHCLFNVPLAVWILEGFMSGVPKEIDETAYIDGYSFPRFFIKIFIPLIASGVGV 197 HIAVALAHCLFN+PLA+WILEGFMS VPKE+DETAYIDGYSFPRFF+ IF+P+I SG+GV Sbjct: 162 HIAVALAHCLFNIPLAIWILEGFMSSVPKEVDETAYIDGYSFPRFFVTIFLPMIRSGIGV 221 Query: 198 AGFFCFMFSWVELLLARTLTTTAAKPISAIMTRTVSASGMDWGVLAAAGVLTIIPGALVI 257 FF FMFSWVELLL+RTLT T A+PI++IMTRT +ASG+DWG LAAAGVLTIIPG +V+ Sbjct: 222 TLFFLFMFSWVELLLSRTLTATNAQPIASIMTRTSTASGIDWGTLAAAGVLTIIPGIVVV 281 Query: 258 YFVRNYIAKGFALGR 272 YFVRN+IAKGFALGR Sbjct: 282 YFVRNHIAKGFALGR 296 Lambda K H 0.330 0.142 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 297 Length adjustment: 26 Effective length of query: 247 Effective length of database: 271 Effective search space: 66937 Effective search space used: 66937 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory