Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_086508400.1 BZY95_RS02350 KR domain-containing protein
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_002151265.1:WP_086508400.1 Length = 255 Score = 276 bits (707), Expect = 2e-79 Identities = 142/255 (55%), Positives = 193/255 (75%), Gaps = 4/255 (1%) Query: 1 MHIANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKARELGDNARFAVADI 60 M + ++ F+++GAASGLGAATA+ LV G +V+L DL+ +AVEA A +LG+ AR D+ Sbjct: 1 MQVKDRTFLITGAASGLGAATAERLVAGGGRVVLCDLS-EAVEAHAEKLGEAARALRGDV 59 Query: 61 SDEQAAQSAVDAAVSAFGS--LHGLVNCAGIVGAEKVLGKQG-PHGLASFAKVINVNLIG 117 + Q+AVDAAV+ G L G+V+CAG+V K++ ++G P L ++A+ + +NL+G Sbjct: 60 TSAADMQAAVDAAVALGGETGLAGVVHCAGVVSVAKLVDREGNPADLDAYARTVQINLVG 119 Query: 118 SFNLLRLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAAR 177 +FN++RLAAAAMA+ A + GERGVI+NTASIAA+DGQ+GQ AY+ASK + ++LPAAR Sbjct: 120 TFNVMRLAAAAMAKNAPSKDGERGVIVNTASIAAFDGQVGQCAYSASKAGVVGMSLPAAR 179 Query: 178 ELARFGIRVMTIAPGIFETPMMAGMSDEVRASLAAGVPFPPRLGRPQEYAALARHIIENS 237 EL+R GIRVM IAPG+F+TPMM+ + DE +LAA VPFP RLG P E+A LA II N+ Sbjct: 180 ELSRHGIRVMAIAPGVFQTPMMSEIPDEAAKALAASVPFPKRLGHPDEFARLAEQIITNA 239 Query: 238 MLNGEVIRLDGALRM 252 MLNGEVIRLDG +RM Sbjct: 240 MLNGEVIRLDGGIRM 254 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 255 Length adjustment: 24 Effective length of query: 231 Effective length of database: 231 Effective search space: 53361 Effective search space used: 53361 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory