Align Probable 2-dehydro-3-deoxygalactonokinase DgoK1; 2-keto-3-deoxy-galactonokinase; 2-oxo-3-deoxygalactonate kinase; EC 2.7.1.58 (characterized)
to candidate WP_086509087.1 BZY95_RS06125 2-keto-3-deoxy-galactonokinase
Query= SwissProt::Q92RN7 (306 letters) >NCBI__GCF_002151265.1:WP_086509087.1 Length = 335 Score = 187 bits (476), Expect = 2e-52 Identities = 125/306 (40%), Positives = 165/306 (53%), Gaps = 13/306 (4%) Query: 7 YAAVDWGTSSFRLWIIGEDGAVLAERRSAEGMTTAAKTGFHTILDGHLAAVSAPA-HLPI 65 + AVDWG+S R W + E G VLA S +GM + + L + P+ H+P+ Sbjct: 11 WVAVDWGSSQLRAWGLDERGEVLARGGSDKGMLALTQVEYEPALLEAIGEWLPPSGHVPV 70 Query: 66 IICGMAGARQGWKEAGYIETPAALAEIAGRATA--IPDVDRDIRILPGLAQRD---RRHP 120 ICGMAGARQGW EA Y+ PA L ++A A A + D ++ +LPGL Q +R Sbjct: 71 WICGMAGARQGWCEAAYLPLPARLDQLARGAVAPAVGDPRLNVCLLPGLCQYADGAQRSF 130 Query: 121 DVMRGEETQLLGAAAHLGAGSHLVCMPGTHSKWVRLADDRVEGFSTFMTGELFDTIARHT 180 DVMRGEETQL G A S L C+PGTH+KWV L V F+T +TGEL+ +A + Sbjct: 131 DVMRGEETQLAGLVAREPGFSGLACLPGTHAKWVWLEAGTVVRFATCLTGELYGLLAGQS 190 Query: 181 ILSHAVAEADTFAAG-SAAFTDAVSRTRENPALATNLLFSVRAGQLL-----HGTA-AAD 233 +L H+VA+A G AFTDAV P + LF +RA LL HG A A Sbjct: 191 VLRHSVADAALDEPGCREAFTDAVREAASTPGRFSQQLFGLRAADLLDDSLPHGQARRAR 250 Query: 234 ARAQLSGTLIGLEIAGALAGSGSVDGVCLVGSGGLGTLYRTALESQGLNVRAVDADEAVR 293 A+LSG IGLE++ S V L+G+ L Y AL + G + R +D + AV Sbjct: 251 LGARLSGLTIGLELSALTDELPSDAAVTLIGNATLCDRYALALSALGRSSRHLDGETAVL 310 Query: 294 AGLSAA 299 AG+ A Sbjct: 311 AGIELA 316 Lambda K H 0.319 0.133 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 335 Length adjustment: 28 Effective length of query: 278 Effective length of database: 307 Effective search space: 85346 Effective search space used: 85346 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory