Align Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (characterized)
to candidate WP_086509737.1 BZY95_RS09725 dihydrolipoamide acetyltransferase
Query= reanno::Marino:GFF1672 (378 letters) >NCBI__GCF_002151265.1:WP_086509737.1 Length = 399 Score = 237 bits (605), Expect = 4e-67 Identities = 134/241 (55%), Positives = 177/241 (73%), Gaps = 16/241 (6%) Query: 1 MTDKAMVEITAPKAGRVTKLYHQQQAMAKVHAPLFAFIPRDREEPEEART---KPEPAA- 56 MTDKA+VEITAP+AG V+KL+ + +AKVHAPL+A++P EP EA+ +P P+A Sbjct: 162 MTDKALVEITAPEAGTVSKLHVAKGEIAKVHAPLYAYVPA-HAEPGEAQVDLGQPSPSAP 220 Query: 57 QLSTATASPVAAASRQ---RIPASPAVRRLVREHELNLSDIQGSGKDGRVLKADVLAYIE 113 Q + +PVA+ R RIPASPAVRRLVREH L+L + GSGKDGRVLK DVL ++E Sbjct: 221 QAAQNRVAPVASGGRGPYGRIPASPAVRRLVREHGLDLEVVAGSGKDGRVLKEDVLRFLE 280 Query: 114 EGPKQ------AQNQAPADDAQTATTRSARRAPAADQEARVEPIRGIKAAMAKSMVKSAT 167 +GP+Q A+ +PA ++T + + R A E RVEPIRG++A MA+ MV+SA+ Sbjct: 281 QGPQQQGEPPAARPASPAPQSETPSGAAPSRHAAG--EVRVEPIRGVRAVMARRMVESAS 338 Query: 168 TIPHFIYSEDIDVTDLLKLREQLKPEAEARGSRLTLMPFFMKAMALAVQEFPVLNSQLND 227 T+PHF Y E+IDVT+LL LRE+LKP AEA+ RLTLMPFFMKA+ALAV+E P+LN++LN Sbjct: 339 TVPHFQYGEEIDVTELLALRERLKPAAEAQQVRLTLMPFFMKALALAVREEPILNARLNP 398 Query: 228 D 228 + Sbjct: 399 E 399 Score = 75.1 bits (183), Expect = 3e-18 Identities = 58/157 (36%), Positives = 83/157 (52%), Gaps = 13/157 (8%) Query: 1 MTDKAMVEITAPKAGRVTKLYHQQQAMAKVHAPLFAFIPRDREEPEEARTKPEPAAQLST 60 MTDKA+VEITAP+AGRVT+LY + +AKVHAPLFA+ + E T P PAA+ Sbjct: 39 MTDKALVEITAPEAGRVTRLYVAKGDIAKVHAPLFAY---EATGEVEFETPPRPAAREED 95 Query: 61 ATASPVAAASRQRIPASPAVRRL---VREHELNLSDIQGSGKDGRVLKADVLAY-IEEGP 116 SP A A +SPA R + + L DI G G +++ +V+ + + EG Sbjct: 96 EVVSPAAEAPPPAASSSPADGRAATSAKAKDFILPDI-GEG----IVECEVVEWRVGEGD 150 Query: 117 KQAQNQAPADDAQTATTRSARRAPAADQEARVEPIRG 153 + A++Q P D T AP A +++ +G Sbjct: 151 EIAEDQ-PLVDVMTDKALVEITAPEAGTVSKLHVAKG 186 Lambda K H 0.316 0.131 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 378 Length of database: 399 Length adjustment: 30 Effective length of query: 348 Effective length of database: 369 Effective search space: 128412 Effective search space used: 128412 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory