Align Hydroxymethylglutaryl-CoA lyase YngG; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 (characterized)
to candidate WP_086508285.1 BZY95_RS01745 hydroxymethylglutaryl-CoA lyase
Query= SwissProt::O34873 (299 letters) >NCBI__GCF_002151265.1:WP_086508285.1 Length = 308 Score = 257 bits (656), Expect = 3e-73 Identities = 138/297 (46%), Positives = 184/297 (61%), Gaps = 4/297 (1%) Query: 6 KVTIKEVGPRDGLQNEPVWIATEDKITWINQLSRTGLSYIEITSFVHPKWIPALRDAIDV 65 ++ I EV PRDG Q E ++ T DKI I+ LS TGL+ IE+TSFV PK IP LRDA +V Sbjct: 3 QLQINEVAPRDGFQIEATFVPTADKIRLIDALSATGLARIEVTSFVSPKAIPNLRDAAEV 62 Query: 66 AKGIDREKGVTYAALVPNQRGLENALEGGINEACVFMSASETHNRKNINKSTSESLH--- 122 GI R V LVPN +GLE ALE ++E + MSAS++H N+ + +SL Sbjct: 63 VSGIQRRDDVGITVLVPNVKGLERALECRVDEVNLVMSASDSHGLANLRMTPEQSLEQFA 122 Query: 123 -ILKQVNNDAQKANLTTRAYLSTVFGCPYEKDVPIEQVIRLSEALFEFGISELSLGDTIG 181 I++ + D + N+ A LST FGCP+E +VP +V+ L E G+ ++L DT G Sbjct: 123 AIVEVLRGDPRGRNVFVNASLSTSFGCPFEGEVPEARVLELVERQLALGVQGVTLCDTTG 182 Query: 182 AANPAQVETVLEALLARFPANQIALHFHDTRGTALANMVTALQMGITVFDGSAGGLGGCP 241 ANPAQV + EA ARFP LHFH+TRG LAN + A Q GI FD S GGLGGCP Sbjct: 183 MANPAQVARLCEAAQARFPGIPFTLHFHNTRGMGLANALAAWQAGIVRFDASLGGLGGCP 242 Query: 242 YAPGSSGNAATEDIVYMLEQMDIKTNVKLEKLLSAAKWIEEKMGKPLPSRNLQVFKS 298 YAPG++GN TED+V+M EQM + T V L+ LL+A+ + +G P + ++ K+ Sbjct: 243 YAPGATGNVCTEDLVHMFEQMGVSTGVDLDALLAASAMLPALVGHDTPGQVVKAGKA 299 Lambda K H 0.315 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 308 Length adjustment: 27 Effective length of query: 272 Effective length of database: 281 Effective search space: 76432 Effective search space used: 76432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory