Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate WP_086508386.1 BZY95_RS02275 acyltransferase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1170 (264 letters) >NCBI__GCF_002151265.1:WP_086508386.1 Length = 300 Score = 111 bits (278), Expect = 2e-29 Identities = 93/294 (31%), Positives = 141/294 (47%), Gaps = 33/294 (11%) Query: 1 MRVALYQCPPLP---LDVAGNLQRLQQLALEAKGADLLVLPEMFLTGYNIGVDAVSV--L 55 ++V L Q P P +A + +++LA A GA+L++L E+ T Y + + L Sbjct: 5 LKVGLVQQPAWPDKTKSLAESEAGVRELA--AAGAELVLLQELHATHYFCQYEDTELFDL 62 Query: 56 AEVYNGESAQQVARIAKAAGIAILYGYPERTEDGQIYNAVQLIDSDGERVCNYRKTHLFG 115 AE +G + Q++A +A GI ++ ER G +N + D D RV YRK H+ Sbjct: 63 AEPLDGPTGQRLAALAAELGIVLVGSLFERRAPGLYHNTAVVYDGDRGRVGVYRKMHIPD 122 Query: 116 D---LDHSMFSAGSDE------FPIVELNGWKLGFLICYDLEFPENARRLALAGAELILV 166 D + F+ G + F ++ + +LG L+C+D +PE AR +ALAGAE++L Sbjct: 123 DPGFYEKFYFAPGDQDDSRKQGFQPIDTSVGRLGLLVCWDQWYPEAARLMALAGAEVLLY 182 Query: 167 PTA-NMIPFDFVAD---------VTVRARAFENQCYVAYANYCGHEGD-------IHYCG 209 PTA P D + + R+ A N V AN GHE D I + G Sbjct: 183 PTAIGWSPSDDDGEKARQKEAWTLIQRSHAVANGLPVVVANRVGHEPDHSGVGEGIDFWG 242 Query: 210 QSSIAAPDGSRIAQAGLDESLIVGELDRQLMVDSRAANRYLLDRRPELYGELNK 263 S +A P G +A AG + ++ LD D R YL DRR + YG+L + Sbjct: 243 GSFVAGPQGELLAHAGTEAERMLVTLDMSRGEDVRRIWPYLRDRRIDAYGDLTR 296 Lambda K H 0.321 0.139 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 300 Length adjustment: 26 Effective length of query: 238 Effective length of database: 274 Effective search space: 65212 Effective search space used: 65212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory