Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate WP_086510082.1 BZY95_RS11605 carbon-nitrogen hydrolase family protein
Query= reanno::pseudo5_N2C3_1:AO356_14225 (264 letters) >NCBI__GCF_002151265.1:WP_086510082.1 Length = 291 Score = 69.3 bits (168), Expect = 9e-17 Identities = 53/153 (34%), Positives = 72/153 (47%), Gaps = 6/153 (3%) Query: 84 ERGEDGQIYNAVQLIDAQGERLANYRKSHLFGDLDHAMFSAGDSALPIVELNGWKLGLLI 143 ER E G IYN + +ID G+ +A YRK F + + S + + V N + G+ I Sbjct: 86 ERTESG-IYNTLSVIDPSGQVVARYRKMFPFRPYEAGVESGTEFVVFDVP-NVGRFGVSI 143 Query: 144 CYDLEFPENARRLALAGAELILVPTANMQPYEFIADVTVRARAIENQCFVAYANYCGHEA 203 CYD+ FPE R LA GAE+IL PT I R A NQC+ N G Sbjct: 144 CYDMWFPETTRTLAAMGAEVILHPTMTDTIDRDIELSIARTNAAVNQCYFFDINGAGALG 203 Query: 204 ELQYCGQSSIAAPNGSRPALAGLDEALIVGELD 236 G+S + P+G AG E ++ E+D Sbjct: 204 N----GRSIVVGPSGDVIHQAGTGEEIMPIEVD 232 Lambda K H 0.321 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 291 Length adjustment: 25 Effective length of query: 239 Effective length of database: 266 Effective search space: 63574 Effective search space used: 63574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory