Align 3-hydroxybutyryl-CoA dehydratase; EC 4.2.1.55 (characterized)
to candidate WP_086511176.1 BZY95_RS17490 enoyl-CoA hydratase
Query= CharProtDB::CH_091794 (261 letters) >NCBI__GCF_002151265.1:WP_086511176.1 Length = 257 Score = 251 bits (640), Expect = 1e-71 Identities = 128/241 (53%), Positives = 172/241 (71%) Query: 14 VAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFVAGADISEMKE 73 V +TINRPKALNALNS L E++ ++ E+E S++ A+++TGAGEK+FVAGADI+EM+ Sbjct: 14 VVRLTINRPKALNALNSAVLTELEALLTELEKRSDLRALLITGAGEKAFVAGADITEMRT 73 Query: 74 MNTIEGRKFGILGNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCDIRIASSNARFGQP 133 E R F + +RLE L PV+A VNGF LGGGCE+A++CD +AS NA FGQP Sbjct: 74 KTPEEARAFASQALRTIKRLETLPVPVVALVNGFCLGGGCELALACDWAVASDNAIFGQP 133 Query: 134 EVGLGITPGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVEPSELMNTAK 193 EV LG+ PGFGGTQRL R VG MA L+ T + I A EALRIGLVN+V+ +EL A+ Sbjct: 134 EVLLGVIPGFGGTQRLPRRVGPAMALDLVTTGRKIDAQEALRIGLVNRVMPQAELEAYAE 193 Query: 194 EIANKIVSNAPVAVKLSKQAINRGMQCDIDTALAFESEAFGECFSTEDQKDAMTAFIEKR 253 E+ ++ N P+AV+ +KQA++ GM D+D+ALA E+ F F+ +QK+ M+AF+EKR Sbjct: 194 ELTKQLAGNGPLAVRSAKQAVHDGMDQDLDSALALETSLFALGFAGSEQKEGMSAFVEKR 253 Query: 254 K 254 K Sbjct: 254 K 254 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 257 Length adjustment: 24 Effective length of query: 237 Effective length of database: 233 Effective search space: 55221 Effective search space used: 55221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory