Align 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) (characterized)
to candidate WP_086511177.1 BZY95_RS17495 3-hydroxybutyryl-CoA dehydrogenase
Query= BRENDA::Q0KEY8 (284 letters) >NCBI__GCF_002151265.1:WP_086511177.1 Length = 282 Score = 306 bits (783), Expect = 4e-88 Identities = 153/282 (54%), Positives = 205/282 (72%), Gaps = 1/282 (0%) Query: 1 MSIRTVGIVGAGTMGNGIAQACAVVGLNVVMVDISDAAVQKGVATVASSLDRLIKKEKLT 60 M+ + +G+VGAGTMG GIAQ G + D++D + + A + L +L+ KEKL+ Sbjct: 1 MTQQAIGVVGAGTMGQGIAQVLVASGFATRLYDVADEQLGRAQAVIDKGLGKLVAKEKLS 60 Query: 61 EADKASALARIKGSTSYDDLKATDIVIEAATENYDLKVKILKQIDGIVGENVIIASNTSS 120 EADKA A+AR++ +TS + L+ +++IEAA E LK K+ + + + + I+ASNTSS Sbjct: 61 EADKAEAMARLETTTSLEALRGCEVIIEAAPEQPALKEKLFRDLSRL-SHDAILASNTSS 119 Query: 121 ISITKLAAVTSRADRFIGMHFFNPVPVMALVELIRGLQTSDTTHAAVEALSKQLGKYPIT 180 +S+T+LAAV R +R +GMHFFNPVPV+ LVE+IR QTSD T A +E L++QLGK P+ Sbjct: 120 LSLTRLAAVCERPERVVGMHFFNPVPVLKLVEVIRAEQTSDATAARIEELTRQLGKTPVA 179 Query: 181 VKNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGCNHPIGPLALADMIGLDTM 240 + +SPGF VNR+L PMINEA +L EG AS E+ID+ M+LG HP+GPLALAD+IGLD Sbjct: 180 IADSPGFAVNRLLIPMINEAAFLLQEGAASAEDIDQSMQLGAAHPMGPLALADLIGLDVC 239 Query: 241 LAVMEVLYTEFADPKYRPAMLMREMVAAGYLGRKTGRGVYVY 282 LA+MEVL F DPKYRP L+R MVAAGYLGRK+GRG +VY Sbjct: 240 LAIMEVLQEGFGDPKYRPCPLLRRMVAAGYLGRKSGRGFHVY 281 Lambda K H 0.319 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 282 Length adjustment: 26 Effective length of query: 258 Effective length of database: 256 Effective search space: 66048 Effective search space used: 66048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory