Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate WP_086510406.1 BZY95_RS13300 isovaleryl-CoA dehydrogenase
Query= BRENDA::Q3JP94 (395 letters) >NCBI__GCF_002151265.1:WP_086510406.1 Length = 389 Score = 212 bits (540), Expect = 1e-59 Identities = 132/375 (35%), Positives = 202/375 (53%), Gaps = 2/375 (0%) Query: 14 LDQQLADDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLGPTIPEQYG 73 LD L D+ M+RD +A+A+ ++APR E ++++ G++GLLG T+PE+ G Sbjct: 8 LDFGLDDELNMLRDQVNAFARDEIAPRAAEIDEKNEFPNDLWQKFGDMGLLGITVPEEDG 67 Query: 74 GPGLDYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPIFEFGSDAQKEKYLPKLATGEWI 133 G G+ Y+++ + E+ R + S+L + + + QK KYLPKL +GE I Sbjct: 68 GTGMGYLAHCIAMEEISRASASVGLSYGAHSNLCVNQLKINANAEQKAKYLPKLISGEHI 127 Query: 134 GCFGLTEPNHGSDPGSMVTRARKVPGGYSLSGSKMWITNSPIADVFVVWAKLD-EDGRDE 192 G ++EP GSD SM RAR+ Y L+G+KMWITN P ADV VV+AK D E G Sbjct: 128 GALAMSEPGAGSDVVSMKLRARQEGDKYILNGNKMWITNGPDADVLVVYAKTDPEAGSKG 187 Query: 193 IRGFILEKGCKGLSAPAIHGKVGLRASITGEIVLDEAFVPEENIL-PHVKGLRGPFTCLN 251 I FI+EKG G S K+G+R S T E+V + VP EN+L KG+R + L+ Sbjct: 188 ITAFIIEKGMPGFSTAQKLDKLGMRGSNTCELVFQDCEVPVENVLGDEGKGVRVLMSGLD 247 Query: 252 SARYGIAWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQTEITLGLQGVL 311 R +A G +G ++ + YV +RKQF + + QL+Q K+ADM T + + Sbjct: 248 YERTVLAAGPIGIMQAAMDVVVPYVHERKQFNQSIGEFQLVQGKIADMYTTLNACRAYLY 307 Query: 312 RLGRMKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVN 371 + D G + + + + KA +A A +LGGNG +E+ R L + ++ Sbjct: 308 AVAAACDRGQTSRKDAAGVILYCAEKATQVALDAIQLLGGNGYINEYPTGRLLRDAKLYE 367 Query: 372 TYEGTHDIHALILGR 386 GT +I +++GR Sbjct: 368 IGAGTSEIRRMLIGR 382 Lambda K H 0.320 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 389 Length adjustment: 31 Effective length of query: 364 Effective length of database: 358 Effective search space: 130312 Effective search space used: 130312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory