Align mannitol 2-dehydrogenase (EC 1.1.1.67) (characterized)
to candidate WP_086510920.1 BZY95_RS16145 alcohol dehydrogenase
Query= BRENDA::Q8KQG6 (338 letters) >NCBI__GCF_002151265.1:WP_086510920.1 Length = 343 Score = 165 bits (417), Expect = 2e-45 Identities = 96/318 (30%), Positives = 171/318 (53%), Gaps = 11/318 (3%) Query: 1 MEALVLTGTKKLEVKDIDRPKVLPNEVLIHTAFAGICGTDHALYAGLPGSADAVPPIVLG 60 M+A + V + + P+ EVL+ AFAGICG+D + G +A P + G Sbjct: 1 MKAFQVNAPLDYAVVETEAPRAAAGEVLVKVAFAGICGSDMHIIHG--DNAFVRFPRITG 58 Query: 61 HENSGVVAEIGSAVTNVKVGDRVTVDPNIYCGQCKYCRTARPELCENLSAVGVTRDGGFE 120 HE +G V +G V +++G RV +DP + CG+C CR RP +C L +GV RDGGFE Sbjct: 59 HEFAGTVEALGEGVEGIEIGARVCIDPVVSCGRCYPCRIGRPNVCSALQVIGVHRDGGFE 118 Query: 121 EFFTAPASVVYPIPDNVSLKSAAVVEPISCAVHGIQLLKVTPYQKALVIGDGFMGELFVQ 180 E+ PA+ V+ +P+ + L++ A+VEP S A + ++ ++ + L+ G G +G +Q Sbjct: 119 EWVNVPAANVHLLPEGLGLEAGALVEPYSIAANVLERMQPLRGDRLLIYGAGVIGLTILQ 178 Query: 181 ILQAYGIHQVDLAGIVDEKLAMNKEKFGVKNTYNTMK-----GDKIPEGE-YDVIIEAVG 234 + +A G+ + + +++E+LA +E G T++ + ++ GE +I +A Sbjct: 179 MARALGLEDITVIDLIEERLATARE-LGATRTWHGKEDVEAAAHELTGGEGMPLIADAAC 237 Query: 235 LPQTQEAAIEASARGAQVLMFGVGGPDAKFQMNTYEVFQKQLTIQGSFINPNAFEDSLAL 294 +P + ++ ++ + G + + EV +K+LT+ GS +N F + L Sbjct: 238 VPALLPQMLRIASPAGRIGLLGFNPTPS--DLVQLEVIKKELTLVGSRLNNRKFPEVLER 295 Query: 295 LSSGKLNVEALMSHELDY 312 ++SG+L+ AL+SH L + Sbjct: 296 MASGRLDPLALVSHRLPF 313 Lambda K H 0.317 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 343 Length adjustment: 28 Effective length of query: 310 Effective length of database: 315 Effective search space: 97650 Effective search space used: 97650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory