Align SmoE, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_086511131.1 BZY95_RS17260 sugar ABC transporter substrate-binding protein
Query= TCDB::O30831 (436 letters) >NCBI__GCF_002151265.1:WP_086511131.1 Length = 434 Score = 525 bits (1351), Expect = e-153 Identities = 250/421 (59%), Positives = 309/421 (73%), Gaps = 1/421 (0%) Query: 15 AALSSAAGAETITVATVNNGDMIRMQGLMSEFNAQHPDITVEWVTLEENVLRQKVTTDIA 74 AA ++AA AETITVATVNN DM+ MQ L S F HP I V WV LEENVLRQ++TTDIA Sbjct: 14 AAFATAAQAETITVATVNNNDMVIMQSLTSAFEEAHPGIRVNWVVLEENVLRQRLTTDIA 73 Query: 75 TKGGQFDVLTIGTYEVPIWGKQGWLVSLNDLPPEYDADDILPAIRNGLTVDGELYAAPFY 134 T GGQFDV+TIGTYE PIW ++GWLV+L+DLP +D+L +R+GL+ +G LYA PFY Sbjct: 74 TDGGQFDVMTIGTYEAPIWAERGWLVALDDLPEASQEEDLLKPVRDGLSHNGSLYALPFY 133 Query: 135 GESSMIMYRKDLMEKAGLTMPDAPTWDFVKEAAQKMTDKDAEVYGICLRGKAGWGENMAF 194 ESSM+ YR DL E+AG+ MP+ P+W+ V+E A ++ D ++ GICLRGK GWGENMAF Sbjct: 134 AESSMLYYRTDLFEEAGIEMPEQPSWEEVREWAAELHDPANQLAGICLRGKPGWGENMAF 193 Query: 195 LSAMANSYGARWFDENWQPQFDGEAWKATLTDYLDMMTNYGPPGASKNGFNENLALFQQG 254 +S + N++G RWFDE W P+ D AW+ + Y+D++ NYGPPGAS NGFNENLALF +G Sbjct: 194 VSTLVNTFGGRWFDEEWNPELDSPAWQEAIGFYVDLLGNYGPPGASSNGFNENLALFSRG 253 Query: 255 KCGMWIDATVAASFVTNPEESTVADKVGFALAPDTGKGKRANWLGAWNLAIPAGSQKVDA 314 C MW+DAT AA + NP ES VAD++GFA AP K A+WL +W LAIPA S+K +A Sbjct: 254 NCAMWVDATSAAGKLYNPAESQVADRLGFAPAPVAETPKGAHWLWSWALAIPASSEKQEA 313 Query: 315 AKQFIAWATSKDYAELVASKEGWANVPPGTRTSLYENPEYQK-VPFAKMTLDSINAADPT 373 A+ F+ WATS++Y ELV +GW +VPPGTR S Y N YQ+ PFA LD+IN+ADPT Sbjct: 314 AQTFLTWATSQEYIELVGETQGWTSVPPGTRESTYANENYQREAPFAGFVLDAINSADPT 373 Query: 374 HPAVDPVPYVGVQFVAIPEFQGIGTAVGQQFSAALAGSMSAEQALQAAQQFTTREMTRAG 433 ++P PYVGVQFV IPEFQ IGT VGQ +AAL G EQALQ AQ+ T R M RAG Sbjct: 374 DSTLEPSPYVGVQFVGIPEFQSIGTQVGQTIAAALTGDTGVEQALQNAQRATARTMQRAG 433 Query: 434 Y 434 Y Sbjct: 434 Y 434 Lambda K H 0.316 0.131 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 628 Number of extensions: 28 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 434 Length adjustment: 32 Effective length of query: 404 Effective length of database: 402 Effective search space: 162408 Effective search space used: 162408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory